Recombinant Bacillus amyloliquefaciens Protoheme IX farnesyltransferase 2 (ctaB2)

Shipped with Ice Packs
In Stock

Description

Table 1: Genomic Comparison of ctaB2 in B. amyloliquefaciens Strains

GeneProduct/FunctionIdentity (%) (Bam1 vs. FZB24)
ctaB2Protoheme IX farnesyltransferase97.39
ctaAHeme A synthase95.47
qoxACytochrome aa3-600 oxidase98.01

This gene cluster (ctaA-ctaB2-qoxABCD) is essential for heme-dependent terminal oxidases in aerobic respiration .

Enzymatic Mechanism and Functional Role

ctaB2 catalyzes the addition of a farnesyl group to protoheme IX, forming heme O. This modification is critical for:

  • Respiratory Chain Assembly: Heme O serves as a precursor for heme A in cytochrome aa3-type oxidases, which are vital for oxidative phosphorylation .

  • Bacterial Virulence: In Staphylococcus aureus, ctaB deletion attenuates virulence and disrupts persister cell formation, highlighting its role in pathogenicity .

Functional studies in E. coli demonstrate that recombinant ctaB2 maintains activity across substrates, confirming its utility in heterologous systems .

Recombinant Production and Purification

Recombinant ctaB2 is typically expressed in E. coli with an N-terminal His tag for purification . Key parameters include:

  • Expression Vector: Bicistronic plasmids with folding-assisting prodomains (e.g., from Streptomyces caniferus) to prevent premature enzyme activation .

  • Yield: Produced in Tris-based buffers with 50% glycerol, stored at -20°C for stability .

Applications in Biotechnology

  • Industrial Enzyme Production: B. amyloliquefaciens is a preferred host for recombinant enzymes due to its robust secretion machinery and GRAS status .

  • Metabolic Engineering: ctaB2’s role in heme biosynthesis enables its use in optimizing bacterial respiratory pathways for biofuel or antibiotic production .

  • Research Tool: Used to study heme biosynthesis mutations and their effects on bacterial persistence .

Research Findings and Future Directions

  • Enzyme Optimization: Overexpression of ctaB2 in B. subtilis increased menaquinone-7 (MK-7) production by 93% under shaking conditions, linking heme metabolism to redox cofactor synthesis .

  • Pathogenicity Studies: ctaB2 deletion in S. aureus reduced ribosomal gene expression by 20%, impairing amino acid biosynthesis and virulence .

Future work may focus on structural resolution of ctaB2 to engineer variants with enhanced thermostability or substrate specificity.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify this during your order; we will prioritize its development.
Synonyms
ctaB2; RBAM_014740; Protoheme IX farnesyltransferase 2; Heme B farnesyltransferase 2; Heme O synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42) (Bacillus amyloliquefaciens subsp. plantarum)
Target Names
ctaB2
Target Protein Sequence
MANSRILNDTAIDGQIEETTAWKDFLSLIKIGIVNSNLITTFTGMWLALHISGLSFLGNL NTVLLTLIGSSLIIAGSCAVNNYYDRDIDHLMERTKVRPTVTGKIQPNQALWSGILLIAL GLIMLLMTTVMAAVIGFIGVFTYVVLYTMWTKRRYTINTVVGSVSGAVPPLIGWTAVEGH IGVVAWVLFMILFIWQIPHFLALAIKKTEDYRAANIPMLPVVHGFEVTKRQIIVWVACLL PLPFFLGSLGLPIVILGTLLNVGWLVLGLMGFRMKNIMKWATLMFVYSLNYMTIYFVAMV VFTLF
Uniprot No.

Target Background

Function

This recombinant Bacillus amyloliquefaciens Protoheme IX farnesyltransferase 2 (ctaB2) catalyzes the conversion of heme B (protoheme IX) to heme O. This conversion involves the substitution of the vinyl group at carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group.

Database Links
Protein Families
UbiA prenyltransferase family, Protoheme IX farnesyltransferase subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should recombinant ctaB2 be stored for optimal stability?

For optimal stability of recombinant ctaB2, store the lyophilized powder at -20°C to -80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles, which can significantly reduce enzyme activity. When stored as a reconstituted solution, working aliquots can be kept at 4°C for up to one week.

For reconstitution, centrifuge the vial briefly before opening to bring contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) and then aliquot for long-term storage at -20°C/-80°C .

Storage ConditionRecommendationDuration
Lyophilized powder-20°C to -80°CLong-term
Working solution4°CUp to one week
Reconstituted with glycerol-20°C to -80°CLong-term

What expression systems are suitable for recombinant ctaB2 production?

The recombinant Bacillus amyloliquefaciens Protoheme IX farnesyltransferase 2 has been successfully expressed in E. coli expression systems. For research purposes, the recombinant protein is typically produced with an N-terminal His-tag to facilitate purification using affinity chromatography.

When designing expression systems for ctaB2, researchers should consider:

  • Codon optimization for the host organism (especially important for bacterial expression systems like E. coli)

  • Selection of appropriate promoters for controlled expression

  • Inclusion of appropriate purification tags (His-tag being commonly used)

  • Growth conditions that maximize protein yields while maintaining proper folding

The resulting recombinant protein is typically obtained at purities greater than 90% as determined by SDS-PAGE analysis .

How can I properly design enzyme kinetics experiments for ctaB2?

Designing robust enzyme kinetics experiments for ctaB2 requires careful consideration of multiple factors to ensure reproducibility and accurate parameter estimation:

  • Buffer selection and pH control: Use appropriate buffers with adequate buffering capacity at the desired pH. For instance, if using acetate buffer at pH 3.6 with sodium formate (as might be done for related enzymes), ensure that the buffer's capacity is sufficient to maintain the desired pH after addition of all components. Always specify the counter-ions (e.g., sodium acetate rather than just "acetate") in your protocol documentation .

  • Substrate concentration ranges: Design experiments with substrate concentrations spanning at least 0.2× to 5× the expected Km value. For a two-substrate enzyme like ctaB2, when determining kinetic parameters:

    • Conduct initial experiments to estimate approximate Km values

    • When varying one substrate, maintain the other at a saturating concentration (typically 10× Km)

    • Clearly state whether reported parameters are true or apparent values

  • Temperature control: Maintain consistent temperature throughout all experiments, as enzyme kinetics are highly temperature-dependent.

  • Enzyme concentration: Use enzyme concentrations that provide measurable initial rates within linear ranges of assays. Always report enzyme concentrations in the final reaction mixture .

  • Model-based experimental design: Consider implementing closed-loop identification of enzyme kinetics using model-based design of experiments. This approach can systematically identify the correct kinetic model with minimal experiments by:

    • Automating experimental work using programming languages like Python

    • Continuously collecting data (e.g., via UV/Vis spectroscopy)

    • Using algorithms to determine optimal experimental conditions for parameter estimation

What are the critical metadata elements I must report for reproducible ctaB2 enzyme assays?

Reproducibility in enzyme research requires comprehensive reporting of experimental conditions. For ctaB2 assays, ensure documentation of the following critical metadata elements:

  • Complete assay composition:

    • Enzyme concentration with method of determination

    • Concentrations of all substrates, including ranges if varied

    • Buffer composition with counter-ions specified

    • pH of final reaction mixture (not just the buffer)

    • Additional components (salts, cofactors, etc.)

    • Temperature of the assay

  • Kinetic measurement details:

    • Time course data or justification for single time point measurements

    • For single time point assays, evidence that measurements are within the linear range

    • Sample handling between reaction and measurement

  • Data analysis methodology:

    • Equations used to fit kinetic data

    • Software and algorithms employed for parameter estimation

    • Statistical analysis of the parameter estimates

  • Enzyme preparation details:

    • Source and preparation method

    • Purity assessment method and result

    • Storage conditions prior to assay

Studies have shown that common omissions in enzyme function reporting include enzyme concentration, substrate concentrations, and the identity of counter-ions in buffers. These seemingly minor details can significantly impact experimental results and reproducibility .

Consider utilizing standardized reporting frameworks like STRENDA DB, which can help prevent common omissions by requiring entry of all critical parameters before submission .

How can I determine if my ctaB2 protein preparation is properly folded and active?

Assessing the proper folding and activity of recombinant ctaB2 protein preparations involves multiple analytical approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Thermal shift assays to determine protein stability

    • Size-exclusion chromatography to detect aggregation

  • Activity assays:

    • Spectrophotometric assays monitoring the conversion of substrates

    • For ctaB2 specifically, measure the conversion of protoheme IX to heme O

    • Compare specific activity to reference standards if available

  • Ligand binding studies:

    • Isothermal titration calorimetry (ITC) to measure substrate binding

    • Surface plasmon resonance (SPR) for binding kinetics

  • Quality control checks:

    • SDS-PAGE analysis to verify purity (should be >90% for recombinant ctaB2)

    • Western blot using anti-His antibodies to confirm the presence of the His-tag

    • Mass spectrometry to verify the molecular weight and sequence integrity

When reporting activity measurements, ensure you specify the enzyme concentration, assay conditions, and define activity units clearly to enable comparisons across different studies .

How can I implement automated closed-loop identification of kinetic models for ctaB2?

Implementing automated closed-loop identification of kinetic models for ctaB2 requires integrating several computational and experimental components:

  • Automated experimental platform setup:

    • Configure a reactor system (e.g., packed bed reactor for immobilized enzyme)

    • Implement continuous monitoring systems (e.g., UV/Vis spectroscopy for NADH detection if applicable)

    • Set up programmable pump systems for precise control of substrate concentrations

    • Integrate temperature and pH control systems

  • Software framework development:

    • Develop Python scripts to interface with laboratory equipment

    • Implement model discrimination algorithms to evaluate competing kinetic models

    • Design optimal experiment algorithms that maximize information gain

  • Kinetic model candidate generation:

    • Define multiple candidate kinetic models (e.g., ordered bi-bi, random bi-bi, ping-pong mechanisms)

    • Parameterize models with initial estimates

    • Design discrimination criteria based on information theory

  • Execution strategy:

    • Begin with widely spaced experimental conditions

    • Use model-based optimal experimental design to iteratively select conditions that maximize discrimination between candidate models

    • Automatically execute the suggested experiments

    • Update model parameters after each experiment

    • Continue until sufficient discrimination is achieved

This approach has been shown to successfully identify correct kinetic models with as few as 15 experiments for similar enzyme systems, significantly reducing the experimental burden compared to traditional methods .

What approaches can be used to analyze potential inhibition mechanisms affecting ctaB2 activity?

Analyzing inhibition mechanisms affecting ctaB2 activity requires systematic investigation using multiple approaches:

  • Initial inhibition screening:

    • Test activity in the presence of various potential inhibitors at multiple concentrations

    • Calculate percent inhibition to identify compounds for detailed analysis

  • Kinetic analysis for inhibition mechanism determination:

    • Measure initial reaction rates at various substrate concentrations with different fixed inhibitor concentrations

    • Create Lineweaver-Burk, Dixon, and Cornish-Bowden plots to distinguish between:

      • Competitive inhibition

      • Uncompetitive inhibition

      • Noncompetitive inhibition

      • Mixed inhibition

  • Data fitting to inhibition models:

    • Fit data to appropriate equations for each inhibition type

    • Determine inhibition constants (Ki, Ki')

    • Use statistical model selection criteria (AIC, BIC) to identify the best-fitting model

  • Structural analysis:

    • If structural data is available, conduct molecular docking studies

    • Identify potential binding sites for inhibitors

    • Correlate structural insights with kinetic findings

For enzyme assays involving inhibition studies, ensure consistent experimental conditions and report all relevant metadata, including enzyme concentration, substrate ranges, inhibitor concentrations, and buffer composition with counter-ions specified. These details are frequently omitted in published studies but are critical for reproducibility .

How can I distinguish between true and apparent kinetic parameters when studying ctaB2 as a multi-substrate enzyme?

Distinguishing between true and apparent kinetic parameters for multi-substrate enzymes like ctaB2 requires careful experimental design and data analysis:

  • Understanding the distinction:

    • True parameters: Intrinsic properties of the enzyme independent of concentrations of other substrates

    • Apparent parameters: Observed values that depend on the fixed concentrations of other substrates

  • Experimental approach for determining true parameters:

    • Initial velocity studies: Measure initial rates by varying one substrate concentration while maintaining others at saturating levels

    • Global data fitting: Collect data at multiple combinations of substrate concentrations and fit to the complete rate equation

    • Product inhibition studies: Evaluate the mechanism by examining how products inhibit the reaction

  • Data analysis methodology:

    • For a two-substrate enzyme like ctaB2:

      • Fit initial velocity data to appropriate rate equations based on the proposed mechanism

      • Use software capable of global fitting to complex enzyme kinetic models

      • Report parameter estimation uncertainty (standard errors)

  • Reporting guidelines:

    • Clearly state whether parameters are true or apparent

    • For apparent parameters, explicitly specify the concentrations of fixed substrates

    • Include the rate equation used for fitting the data

When reporting kinetic parameters, avoid ambiguity by explicitly stating "The reported Km and kcat values are apparent parameters determined with [substrate B] fixed at X mM." Publications frequently omit these critical details, leading to confusion and irreproducibility in enzyme literature .

How should I handle unexpected deviations from Michaelis-Menten kinetics when studying ctaB2?

When encountering deviations from classical Michaelis-Menten kinetics during ctaB2 studies, follow this systematic approach:

  • Verify experimental conditions:

    • Ensure measurements are taken in the initial rate region (typically <10% substrate conversion)

    • Check for time-dependent changes in enzyme activity (inactivation, product inhibition)

    • Verify buffer capacity, pH stability, and temperature control

    • Examine the influence of reagent purity and potential interfering compounds

  • Consider alternative kinetic models:

    • Substrate inhibition: Test by measuring activity at very high substrate concentrations

    • Cooperativity: Apply Hill equation analysis

    • Multiple substrate binding sites: Evaluate with more complex kinetic models

    • Biphasic kinetics: Consider the possibility of enzyme heterogeneity or multiple catalytic pathways

  • Data analysis approaches:

    • Use non-linear regression rather than linearization methods

    • Apply model selection criteria (AIC, BIC) to determine the most appropriate model

    • Consider using a model-based design of experiments approach to systematically refine your understanding of the kinetic mechanism

  • Common specific deviations and their interpretation:

    • Sigmoidal velocity curves: May indicate allosteric effects or cooperativity

    • Substrate inhibition: Often seen as decreased activity at high substrate concentrations

    • Biphasic Lineweaver-Burk plots: May indicate multiple enzyme forms or complex mechanisms

Remember that apparent deviations can sometimes result from poor data collection practices, such as using single time points for rate determination without confirming linearity of product formation, which has been identified as a common issue in enzyme research .

What statistical approaches are recommended for analyzing enzyme kinetic data for ctaB2?

Robust statistical analysis of enzyme kinetic data for ctaB2 requires appropriate methodologies:

  • Parameter estimation:

    • Use non-linear regression rather than linearized plots (like Lineweaver-Burk)

    • Apply weighted regression when error magnitude varies with substrate concentration

    • Report confidence intervals or standard errors for all parameters

    • Consider bootstrap resampling for more robust error estimation

  • Model selection and validation:

    • Use information criteria (AIC, BIC) to compare alternative kinetic models

    • Conduct lack-of-fit tests to evaluate model adequacy

    • Examine residual plots to check for systematic deviations

    • Apply cross-validation when sufficient data is available

  • Experimental design considerations:

    • Ensure adequate sampling across the substrate concentration range (minimum of 5-7 points)

    • Include substrate concentrations from 0.2× to 5× Km for accurate parameter estimation

    • Replicate experiments to assess reproducibility

    • Consider the use of model-based design of experiments for optimal experimental design

  • Statistical testing:

    • For comparing parameters between experimental conditions, use appropriate statistical tests (t-tests, ANOVA)

    • Apply multiple comparison corrections when necessary

    • For nonparametric data, consider Wilcoxon or Mann-Whitney tests

Chi-square tests and Fisher's exact tests are appropriate when analyzing categorical data, such as comparing characteristics between different experimental groups. For age and other continuous variables, Wilcoxon nonparametric tests and t-tests can be used to determine whether distributions differ significantly between groups .

How can I ensure complete reporting of metadata for ctaB2 enzyme assays to enhance reproducibility?

Ensuring complete metadata reporting for ctaB2 enzyme assays requires attention to frequently overlooked details:

  • Essential components to report:

    • Enzyme concentration with method of determination (frequently omitted in publications)

    • Complete buffer composition including counter-ions (e.g., specify "sodium acetate" rather than just "acetate")

    • Substrate concentration ranges or fixed values

    • Final pH of the complete reaction mixture (not just the buffer pH)

    • Temperature of the assay

    • Detailed enzyme preparation and storage information

  • Kinetic data reporting:

    • For kinetic parameters, clearly state whether values are true or apparent

    • For apparent parameters, specify the fixed concentrations of other substrates

    • Include the equation used to fit the data

    • Report raw time course data when possible, rather than just derived rates

  • Experimental methodology details:

    • For time course experiments, report all time points measured

    • For single time point assays, provide evidence that measurements are within the linear range

    • Detail any data processing or normalization applied

  • Standardized reporting frameworks:

    • Consider using STRENDA DB or similar standardized reporting systems

    • These systems can help prevent common omissions by requiring entry of all critical parameters

    • Studies show that many common reporting omissions would be trapped by utilizing such systems

Commonly Omitted InformationImpact on ReproducibilitySTRENDA DB Verification
Enzyme concentrationCritical - impossible to determine specific activityRequired entry
Counter-ions in buffersSignificant - affects ionic strength and enzyme behaviorRequired if following help recommendations
Fixed substrate concentrations for apparent Km determinationMajor - parameters depend on these valuesRequired entry
Final assay pH (vs. buffer pH)Significant - substrates can alter pHRequired entry
Time points or linearity verificationMajor - non-linear product formation invalidates rate calculationsRequired in future versions

What are common challenges in working with recombinant ctaB2 and how can they be addressed?

Working with recombinant ctaB2 presents several challenges that require specific troubleshooting approaches:

  • Protein solubility issues:

    • Challenge: Recombinant membrane-associated proteins like ctaB2 often have solubility problems

    • Solution: Optimize expression conditions (temperature, inducer concentration), consider fusion tags beyond His-tag, use appropriate detergents or solubilizing agents, and explore refolding protocols from inclusion bodies

  • Activity loss during purification:

    • Challenge: Enzyme may lose activity during purification steps

    • Solution: Minimize purification steps, include stabilizing agents (glycerol, reducing agents), maintain appropriate pH, and consider activity assays at each purification stage

  • Storage stability:

    • Challenge: Activity decreases during storage

    • Solution: Store as aliquoted lyophilized powder at -20°C/-80°C, avoid repeated freeze-thaw cycles, consider addition of stabilizers (5-50% glycerol) for reconstituted enzyme

  • Assay reproducibility:

    • Challenge: Variability in activity measurements

    • Solution: Standardize assay conditions, ensure complete reporting of metadata, control temperature precisely, and verify linearity of product formation

  • Expression yield optimization:

    • Challenge: Low protein yields

    • Solution: Optimize codon usage for expression host, evaluate different promoter systems, adjust induction parameters, and consider alternative expression hosts

For enhanced stability during reconstitution, it is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add glycerol to a final concentration of 5-50% before aliquoting for long-term storage .

How can I optimize experimental conditions for studying ctaB2 enzyme kinetics?

Optimizing experimental conditions for ctaB2 enzyme kinetics studies requires systematic evaluation of multiple factors:

  • Buffer optimization:

    • Evaluate enzyme activity across a range of pH values to determine the optimum

    • Test different buffer systems at the optimal pH to identify any specific buffer effects

    • Ensure adequate buffer capacity and report complete buffer composition including counter-ions

  • Temperature optimization:

    • Determine the temperature optimum by measuring activity across a temperature range

    • For extended assays, verify enzyme stability at the selected temperature

    • Maintain precise temperature control throughout experiments

  • Substrate concentration ranges:

    • For accurate Km determination, use substrate concentrations spanning 0.2× to 5× the expected Km

    • For two-substrate enzymes like ctaB2, optimize the fixed concentration of the second substrate

    • Design experiments to distinguish between different kinetic mechanisms

  • Automated optimization approaches:

    • Consider implementing closed-loop identification of enzyme kinetics using model-based design of experiments

    • This approach can systematically identify optimal conditions with minimal experiments by:

      • Automating experimental work

      • Continuously collecting data

      • Using algorithms to determine optimal experimental conditions

  • Data collection optimization:

    • Determine the minimum number of data points needed for reliable parameter estimation

    • Identify optimal sampling times for progress curve analysis

    • Implement appropriate detection methods with adequate sensitivity and linear range

By applying model-based experimental design principles, researchers can reduce the number of experiments needed while improving the precision of kinetic parameter estimates, as demonstrated in similar enzyme systems .

What are the most relevant research papers and resources for studying ctaB2?

While the specific literature on Bacillus amyloliquefaciens Protoheme IX farnesyltransferase 2 (ctaB2) is limited in the provided search results, researchers interested in this enzyme should consult the following resources:

  • UniProt database: The UniProt entry A7Z4B1 contains sequence information and functional annotations for ctaB2 .

  • Enzyme function reporting guidelines: The paper "An empirical analysis of enzyme function reporting for experimental reproducibility" provides valuable insights into common omissions in enzyme research reporting and how to avoid them .

  • Experimental design resources: "Closed-loop identification of enzyme kinetics applying model-based design of experiments" offers methodology for optimizing experimental approaches to enzyme kinetics .

  • Statistical analysis approaches: The methodologies described in various papers, including appropriate statistical tests for comparing enzyme characteristics and parameter estimation approaches .

  • Commercial sources: Resources like CreativeBiomart offer recombinant ctaB2 protein with detailed technical specifications that can be valuable for standardizing research .

For researchers working with recombinant enzymes, it is recommended to consult the STRENDA (Standards for Reporting Enzyme Data) guidelines, which provide comprehensive recommendations for experimental design, data analysis, and reporting of enzyme function studies .

What is the recommended protocol for measuring ctaB2 activity?

A comprehensive protocol for measuring Protoheme IX farnesyltransferase 2 (ctaB2) activity should include the following components:

  • Material preparation:

    • Reconstitute lyophilized recombinant ctaB2 in deionized sterile water to 0.1-1.0 mg/mL

    • For storage stability, add glycerol to a final concentration of 5-50%

    • Prepare fresh substrate solutions (protoheme IX and farnesyl diphosphate)

    • Prepare reaction buffer with precise pH control and clearly defined counter-ions

  • Reaction setup:

    • Prepare reaction mixtures containing:

      • Buffer system (e.g., 50 mM HEPES pH 7.5 with specified counter-ion)

      • Protoheme IX at appropriate concentration

      • Farnesyl diphosphate at appropriate concentration

      • Defined concentration of recombinant ctaB2 enzyme

      • Any required cofactors or additives

  • Activity measurement:

    • Monitor the formation of heme O using appropriate analytical techniques:

      • HPLC analysis

      • Spectrophotometric monitoring

      • Product-specific detection methods

    • Collect multiple time points to ensure linearity of product formation

    • Include appropriate controls (no enzyme, no substrate controls)

  • Data analysis:

    • Calculate initial reaction rates from the linear portion of progress curves

    • For kinetic parameter determination, fit data to appropriate enzyme kinetic models

    • Report all parameters with statistical measures of uncertainty

  • Complete data reporting:

    • Include all essential metadata:

      • Enzyme concentration and preparation details

      • Complete buffer composition including counter-ions

      • Substrate concentration ranges or fixed values

      • Temperature and pH of the reaction

      • Detailed methodology for activity measurement

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.