Recombinant Bacillus amyloliquefaciens UPF0059 membrane protein RBAM_034100 (RBAM_034100)

Shipped with Ice Packs
In Stock

Description

Production and Purification

RBAM_034100 is produced via recombinant expression in E. coli systems . Critical production parameters include:

Functional Insights

RBAM_034100 is implicated in manganese homeostasis, consistent with its annotation as a Mn²⁺ efflux pump . Functional parallels to B. amyloliquefaciens homologs include:

  • Metal ion regulation: Manganese efflux systems mitigate oxidative stress and support bacterial survival in metal-rich environments .

  • Membrane localization: Structural predictions suggest involvement in transmembrane ion transport .

Table 2: Potential Applications

ApplicationRationaleReference
Metal HomeostasisStudy of bacterial Mn²⁼ regulation mechanisms
Biocontrol AgentBacillus spp. proteins contribute to antifungal activity in agriculture
Enzyme EngineeringHost strain optimization for heterologous protein secretion
Structural BiologyMembrane protein crystallization and functional characterization

Table 3: RBAM_034100 vs. E. coli YebN (MntP)

FeatureRBAM_034100YebN (P76264)
SpeciesBacillus amyloliquefaciensEscherichia coli
Length185 residues188 residues
FunctionMn²⁺ effluxMn²⁺ efflux
Expression HostE. coliE. coli
Sequence Identity~30% (alignment-based estimate)

Future Directions

Research gaps and opportunities include:

  1. Mechanistic Studies: Elucidating RBAM_034100’s role in Mn²⁺ transport via mutagenesis or structural analysis .

  2. Biotechnological Optimization: Leveraging B. amyloliquefaciens metabolic engineering platforms for scaled production .

  3. Agricultural Relevance: Investigating its potential in plant growth promotion or pathogen inhibition .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery information, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; RBAM_034100; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42) (Bacillus amyloliquefaciens subsp. plantarum)
Target Names
mntP
Target Protein Sequence
MSNLFIGELVSLSIMAFALGTDAFSVGLGMGMIQLKKKQIFHIGVVIGLFHVMMPLAGMA AGHLLSGFLGMLAVYIGGSLLFILGVQMIIAAFKQSDGPLISPAGSGLLLFAIGVSLDSF SVGLSLGMNGSNPFLAVTLFGVFSTVLTWAGLLAGRKVQSWLGSYSEALGGAILIGFGLK LLLPV
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus amyloliquefaciens UPF0059 membrane protein RBAM_034100?

Bacillus amyloliquefaciens UPF0059 membrane protein RBAM_034100 (UniProt ID: A7Z9R3) is a 185-amino acid membrane protein belonging to the UPF0059 protein family. The recombinant form is typically expressed with an N-terminal His-tag in E. coli expression systems . The protein is classified as a membrane protein, suggesting its localization within the cell membrane of B. amyloliquefaciens. While the precise function remains under investigation, the UPF0059 family proteins are generally involved in membrane integrity, transport mechanisms, or signal transduction. The protein can be recombinantly produced to facilitate biochemical and structural studies that would otherwise be challenging with native membrane proteins.

What expression systems are optimal for recombinant RBAM_034100 production?

The optimal expression system for RBAM_034100 production is an E. coli-based system, particularly when utilizing an N-terminal His-tag for purification purposes . When designing expression experiments, researchers should consider the following methodological approaches:

For experimental design, implement a blocking structure to control for batch variability, as this reduces experimental noise and improves detection of true effects . Document qualitative observations throughout the expression process, particularly noting changes in culture turbidity, cell pellet coloration, and protein solubility after cell lysis. These observations serve as critical quality control markers that can guide troubleshooting efforts.

What purification strategies yield highest purity RBAM_034100?

The purification of His-tagged RBAM_034100 requires a systematic approach combining multiple chromatographic techniques. The recommended methodology follows:

  • Solubilization: Solubilize membrane fractions using a detergent screening approach with 8-10 different detergents (e.g., DDM, LDAO, OG) at varying concentrations.

  • Initial IMAC purification: Apply solubilized protein to Ni-NTA resin using a step gradient:

    • Binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.1% selected detergent

    • Wash buffer: Binding buffer + 20 mM imidazole

    • Elution buffer: Binding buffer + 250 mM imidazole

  • Secondary purification: Apply IMAC-purified protein to size exclusion chromatography.

When designing the purification experiment, incorporate principles of good experimental design by establishing controlled variables such as buffer composition, temperature, and flow rates . This approach reduces variability within experimental blocks, enhancing detection of true effects and optimizing resource utilization . Document qualitative observations about protein aggregation, stability in different detergents, and elution profiles to inform future purification attempts.

How can researchers optimize experimental design for RBAM_034100 functional studies?

Optimizing experimental design for RBAM_034100 functional studies requires careful consideration of variables and controls. The methodology should follow these principles:

  • Define clear independent and dependent variables:

    • Independent variable (IV): The factor being manipulated (e.g., protein concentration, buffer composition, temperature)

    • Dependent variable (DV): The measured outcome (e.g., binding affinity, enzymatic activity)

  • Implement proper controls:

    • Positive control: Known functional membrane protein from UPF0059 family

    • Negative control: Buffer without protein or denatured protein

    • Technical controls: Account for instrument drift and background

  • Apply blocking techniques to reduce variability:

    • Group experimental units with similar characteristics

    • Randomize treatment assignment within blocks

    • Include replicates across multiple blocks

This approach significantly improves statistical power by reducing noise and increasing the signal-to-noise ratio, allowing detection of subtle functional characteristics with fewer experimental resources . Additionally, clearly document qualitative observations throughout the experiments to identify potential sources of error and guide methodological refinements .

What are the structural analysis methods suitable for RBAM_034100?

Structural analysis of membrane proteins like RBAM_034100 requires specialized techniques due to their hydrophobic nature and integration in lipid bilayers. The following methodological approaches are recommended:

When designing structural biology experiments, implement a three-phase approach:

  • Initial screening phase: Test multiple buffer conditions, detergents, and protein constructs to identify promising candidates.

  • Optimization phase: Refine conditions based on initial results, focusing on protein stability and homogeneity.

  • Data collection phase: Collect high-quality data using optimized samples and processing methods.

This approach embodies good experimental design principles by systematically reducing variables that could affect outcomes . Document qualitative observations about sample behavior, noting factors such as aggregation tendencies, time-dependent stability, and batch-to-batch variability to guide troubleshooting efforts.

How does RBAM_034100 compare to homologous proteins in other bacterial species?

Comparative analysis of RBAM_034100 with homologous UPF0059 family proteins reveals important evolutionary and functional insights. The methodological approach should include:

  • Sequence analysis:

    • Multiple sequence alignment of UPF0059 family members

    • Phylogenetic tree construction to establish evolutionary relationships

    • Conservation analysis of membrane-spanning domains and functional motifs

  • Structural comparison:

    • Homology modeling based on solved structures of homologous proteins

    • Prediction of transmembrane topology and secondary structure elements

    • Identification of conserved binding pockets or catalytic sites

  • Functional annotation transfer:

    • Cross-reference experimental data from well-characterized homologs

    • Predict substrate specificity based on conserved binding site residues

    • Design validation experiments to test functional hypotheses

When designing comparative studies, implement principles of experimental control by standardizing analysis parameters across all sequences and structures being compared . This reduces the risk of bias and ensures that observed differences reflect true biological distinctions rather than methodological artifacts .

What techniques can distinguish between native and recombinant RBAM_034100 properties?

Distinguishing between native and recombinant RBAM_034100 properties requires a systematic experimental approach addressing potential structural and functional differences:

  • Comparative biophysical characterization:

    • Circular dichroism (CD) spectroscopy to compare secondary structure content

    • Thermal stability analysis to measure unfolding temperatures

    • Dynamic light scattering to assess oligomeric state and homogeneity

  • Functional comparison:

    • Binding assays with predicted ligands or interaction partners

    • Reconstitution into liposomes to measure transport or channel activity

    • In vitro association with other membrane components

  • Post-translational modification analysis:

    • Mass spectrometry to identify modifications present in native but not recombinant protein

    • Western blotting with modification-specific antibodies

    • Functional impact of adding or removing specific modifications

When designing these experiments, implement a blocking strategy to control for batch-to-batch variation in both native and recombinant protein preparations . This approach reduces experimental noise and improves the power to detect true differences between the protein forms. Carefully document qualitative observations about differences in stability, solubility, and handling properties between native and recombinant forms .

How can researchers minimize bias in RBAM_034100 experimental studies?

Minimizing bias in RBAM_034100 studies requires rigorous experimental design practices that address potential sources of systematic error:

  • Implement randomization strategies:

    • Randomize sample processing order

    • Blind the analyst to sample identity when possible

    • Distribute technical replicates across different experimental runs

  • Control for nuisance variables:

    • Maintain consistent protein preparations across experiments

    • Standardize buffer compositions and storage conditions

    • Use the same instrument settings for all comparative measurements

  • Apply blocking techniques:

    • Group similar experimental units together

    • Reduce variability within blocks

    • Allow for more precise estimates of treatment effects

What statistical approaches are recommended for analyzing RBAM_034100 experimental data?

The analysis of RBAM_034100 experimental data requires appropriate statistical methods that account for the complexity of biochemical and biophysical measurements:

  • Descriptive statistics:

    • Calculate means, standard deviations, and standard errors

    • Visualize data using appropriate plots (box plots, scatter plots)

    • Identify outliers and assess data distribution

  • Inferential statistics:

    • ANOVA for comparing multiple experimental conditions

    • t-tests for pairwise comparisons with appropriate corrections

    • Non-parametric tests for data that violates normality assumptions

  • Advanced analytical approaches:

    • Mixed-effects models to account for batch effects

    • Principal component analysis for multivariate data

    • Curve fitting for binding or kinetic experiments

When designing the statistical analysis plan, ensure that it aligns with the experimental design structure, particularly if blocking or other variance-reduction techniques were employed . This integrated approach maximizes the power to detect true effects while minimizing the risk of both Type I and Type II errors. Document all statistical methods, including software packages and specific tests used, to enhance reproducibility.

How can researchers address experimental errors in RBAM_034100 studies?

Addressing experimental errors in RBAM_034100 studies requires a systematic approach to error identification, quantification, and mitigation:

  • Identify common sources of error:

    • Protein instability during storage or experiment

    • Detergent interference with analytical techniques

    • Batch-to-batch variation in protein quality

    • Instrument drift or calibration issues

  • Quantify error magnitude and direction:

    • Measure technical variability through replicate analysis

    • Determine the effect of specific error sources on results

    • Calculate error propagation in multi-step analyses

  • Implement error mitigation strategies:

    • Include appropriate controls for each error source

    • Develop standard operating procedures for critical steps

    • Implement quality control checkpoints throughout experiments

What computational approaches support RBAM_034100 research?

Computational approaches offer powerful tools for enhancing RBAM_034100 research, providing insights that may be difficult to obtain experimentally:

  • Molecular dynamics simulations:

    • Model protein behavior in membrane environments

    • Explore conformational dynamics and flexibility

    • Predict effects of mutations on structure and function

  • Docking and virtual screening:

    • Identify potential binding partners or substrates

    • Optimize ligand structures for biochemical validation

    • Predict binding affinities and interaction modes

  • Sequence-based predictions:

    • Identify functionally important residues through conservation analysis

    • Predict protein-protein interaction sites

    • Model evolutionary relationships with homologous proteins

When designing computational studies, implement principles of experimental design by clearly defining dependent and independent variables, even in silico . For example, when performing molecular dynamics simulations, the independent variable might be simulation time or force field parameters, while the dependent variable could be RMSD, hydrogen bonding patterns, or other structural metrics. This structured approach ensures that computational studies yield meaningful, interpretable results that can guide experimental work.

How can researchers optimize protein-protein interaction studies involving RBAM_034100?

Optimizing protein-protein interaction studies for membrane proteins like RBAM_034100 requires specialized approaches that account for the hydrophobic membrane environment:

  • In vitro interaction methodologies:

    • Pull-down assays using His-tagged RBAM_034100 as bait

    • Surface plasmon resonance with detergent-solubilized or nanodisk-embedded protein

    • Crosslinking followed by mass spectrometry to identify interaction sites

  • Experimental design considerations:

    • Define clear independent variables (e.g., detergent type, salt concentration)

    • Establish appropriate controls (e.g., non-interacting proteins)

    • Implement replicate measurements to assess reproducibility

  • Data analysis approach:

    • Apply kinetic modeling for real-time interaction data

    • Use statistical methods to distinguish specific from non-specific interactions

    • Validate interactions through multiple independent techniques

This methodological framework incorporates good experimental design principles by controlling for nuisance variables that might affect interaction detection, such as detergent effects or protein stability . By systematically optimizing each aspect of the interaction study, researchers can obtain more reliable and biologically relevant results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.