Recombinant Bacillus amyloliquefaciens UPF0295 protein RBAM_008830 (RBAM_008830)

Shipped with Ice Packs
In Stock

Description

Protein Overview

RBAM_008830 is a 117-amino acid protein encoded by the gene RBAM_008830, classified under the UPF0295 family of proteins with unknown molecular function . It is produced recombinantly in E. coli with an N-terminal His tag for purification . Key features include:

PropertyDetails
UniProt IDA7Z2P1
Species SourceBacillus velezensis (strain FZB42)
Molecular WeightPredicted ~13 kDa (based on 117 residues)
Amino Acid SequenceMAKYSSKINKIRTFALSLVFVGFIIMYIGLFFKQSVLLASLFMILGLLSIGLSTAVYFWIGMLSTKAVRVMCPACEKETKILGRVDMCMHCREPLTLDKGLEGKAFDESYNRKNSVK
Purity>90% (SDS-PAGE)

Production and Purification

The protein is expressed in E. coli and purified via affinity chromatography using its His tag. Post-purification, it is lyophilized into a powder and stored in Tris/PBS-based buffer with 6% trehalose (pH 8.0) to enhance stability .

Functional and Pathway Associations

While RBAM_008830’s exact biochemical role remains uncharacterized, Bacillus amyloliquefaciens is known for producing enzymes (e.g., proteases, amylases) and bioactive compounds . UPF0295 family proteins are hypothesized to participate in bacterial stress responses or metabolic regulation, but experimental validation for RBAM_008830 is lacking .

Transcriptomic Insights

  • Fructose supplementation in B. amyloliquefaciens upregulates amino acid synthesis and fatty acid metabolism pathways, which could indirectly influence secondary metabolite production .

  • Modular engineering of B. amyloliquefaciens strains enhances heterologous protein yields (e.g., alkaline proteases), suggesting potential strategies for optimizing RBAM_008830 production .

Applications

RBAM_008830 is primarily used in research contexts:

ApplicationDescription
ImmunoassaysCommercial ELISA kits utilize this protein for antibody detection .
Structural StudiesFull-length production supports crystallography or NMR analyses .
Metabolic EngineeringServes as a model for optimizing recombinant protein expression in Bacillus .

Taxonomic and Genomic Context

  • Strain Origin: RBAM_008830 is derived from Bacillus velezensis FZB42 (formerly classified as B. amyloliquefaciens), a soil bacterium used in industrial enzyme production .

  • Genomic Features: The RBAM_008830 gene is part of a conserved genomic region, though its regulatory elements remain unstudied .

Research Gaps and Future Directions

  • Functional Characterization: No experimental data exist on RBAM_008830’s enzymatic activity or interactions.

  • Pathway Mapping: Its involvement in metabolic networks (e.g., amino acid synthesis) requires validation .

  • Biotechnological Potential: Engineering Bacillus hosts for RBAM_008830 overexpression could unlock industrial applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery details, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
RBAM_008830; UPF0295 protein RBAM_008830
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42) (Bacillus amyloliquefaciens subsp. plantarum)
Target Names
RBAM_008830
Target Protein Sequence
MAKYSSKINKIRTFALSLVFVGFIIMYIGLFFKQSVLLASLFMILGLLSIGLSTAVYFWI GMLSTKAVRVMCPACEKETKILGRVDMCMHCREPLTLDKGLEGKAFDESYNRKNSVK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0295 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus amyloliquefaciens UPF0295 protein RBAM_008830?

Bacillus amyloliquefaciens UPF0295 protein RBAM_008830 (UniProt ID: A7Z2P1) is a full-length protein (117 amino acids) belonging to the UPF0295 protein family found in Bacillus amyloliquefaciens, a gram-positive, rod-shaped bacterium known for its beneficial properties in plant growth promotion and biocontrol activities . The "UPF" designation (Uncharacterized Protein Family) indicates that while the protein has been identified and sequenced, its specific biological function remains incompletely characterized. RBAM_008830 represents the specific locus tag in the B. amyloliquefaciens genome, providing a unique identifier for this particular gene product. Based on sequence analysis and structural predictions, this protein likely plays a role in the bacterium's cellular processes, potentially contributing to its antagonistic activities against fungal pathogens observed in B. amyloliquefaciens strains .

How is recombinant RBAM_008830 protein typically expressed for research purposes?

For research applications, recombinant RBAM_008830 protein is typically expressed in E. coli expression systems using the following methodological approach:

  • Vector construction: The full-length gene encoding RBAM_008830 is cloned into an expression vector containing an N-terminal His-tag sequence to facilitate purification.

  • Host selection: E. coli is the preferred expression host due to its rapid growth, high protein yields, and established protocols for heterologous protein expression.

  • Expression conditions:

    • Induction using IPTG (isopropyl β-D-1-thiogalactopyranoside) when using T7-based expression systems

    • Optimization of temperature (typically 16-30°C), induction time, and media composition to enhance soluble protein yield

    • Supplementation with appropriate antibiotics for selection

  • Protein purification:

    • Affinity chromatography using Ni-NTA resin to capture the His-tagged protein

    • Further purification through size exclusion or ion-exchange chromatography if higher purity is required

    • Buffer optimization to maintain protein stability

  • Quality control:

    • SDS-PAGE analysis to confirm purity (>90% purity typically achieved)

    • Western blotting to verify identity

    • Mass spectrometry for precise molecular weight determination

The resulting purified protein is typically provided as a lyophilized powder for extended shelf life and stability .

How should recombinant RBAM_008830 protein be stored and reconstituted for laboratory use?

Proper storage and reconstitution are critical for maintaining the structural integrity and biological activity of recombinant RBAM_008830 protein. The following protocol is recommended:

Storage conditions:

  • Store lyophilized protein at -20°C to -80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Long-term storage requires 5-50% glycerol (final concentration) and storage at -20°C/-80°C

Reconstitution protocol:

  • Centrifuge the vial briefly before opening to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Allow the protein to fully dissolve (gentle vortexing or rotation may assist)

  • For long-term storage, add glycerol to a final concentration of 50%

  • Aliquot to minimize freeze-thaw cycles

Buffer considerations:
The protein is shipped in Tris/PBS-based buffer containing 6% Trehalose, pH 8.0, which helps maintain stability during lyophilization and reconstitution .

How can researchers validate the functional activity of recombinant RBAM_008830 protein?

Validating the functional activity of recombinant RBAM_008830 requires a multi-faceted approach that addresses both structural integrity and biological function:

Structural validation:

  • Circular dichroism (CD) spectroscopy: Assess secondary structure elements to confirm proper folding

  • Thermal shift assays: Evaluate protein stability under different buffer conditions

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Determine oligomeric state and homogeneity

  • Limited proteolysis: Identify stable domains and flexible regions

Functional validation:

  • Activity assays based on predicted function:

    • For membrane proteins: Reconstitution in liposomes and transport/channel activity measurements

    • For binding proteins: Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC)

    • For enzymes: Substrate conversion assays with appropriate controls

  • Interaction studies:

    • Co-immunoprecipitation with potential binding partners

    • Yeast two-hybrid screening

    • Protein microarrays to identify interactors

  • In vivo complementation:

    • Generate knockout strains of B. amyloliquefaciens lacking RBAM_008830

    • Complement with wild-type or mutant versions of the protein

    • Assess restoration of phenotype

  • Localization studies:

    • Fluorescent protein tagging (ensuring tag doesn't interfere with function)

    • Subcellular fractionation followed by Western blotting

    • Immunogold electron microscopy

  • Comparison with related bacterial strains:

    • Functional comparison with the antagonistic activity observed in B. amyloliquefaciens strain BA-4 against fungal pathogens

    • Analysis of protein expression levels under conditions where antagonistic activity is observed

This comprehensive validation approach ensures that the recombinant protein maintains its native structure and biological activity, providing confidence in subsequent experimental results.

What are the recommended controls when conducting antagonistic assays with Bacillus amyloliquefaciens proteins?

When investigating the potential antagonistic properties of RBAM_008830 or other B. amyloliquefaciens proteins against fungal pathogens, the following control measures should be implemented:

Experimental controls:

  • Negative controls:

    • Buffer-only treatment (no bacterial protein)

    • Heat-inactivated protein (to confirm activity is protein-dependent)

    • Unrelated protein of similar size/structure (to confirm specificity)

    • Non-antagonistic Bacillus strain (e.g., lab strain without antifungal properties)

  • Positive controls:

    • Known antifungal compounds (e.g., commercial fungicides)

    • Well-characterized antagonistic Bacillus strains (such as B. amyloliquefaciens BA-4)

    • Purified known antifungal proteins/peptides from Bacillus species

  • Vehicle controls:

    • Same buffer composition without protein

    • Matching concentration of any stabilizing agents (glycerol, trehalose, etc.)

Methodological controls:

  • Plate confrontation assay setup:

    • Standardized inoculation distances between bacterial and fungal cultures

    • Consistent media composition and incubation conditions

    • Multiple technical replicates per biological replicate

  • Growth measurements:

    • Multiple time points to establish growth curves

    • Measurement of fungal growth parameters (colony diameter, biomass) using standardized methods

    • Documentation of morphological changes with microscopy

  • Concentration dependency:

    • Dose-response experiments with varying protein concentrations

    • Determination of minimum inhibitory concentration (MIC)

Data analysis controls:

  • Normalization:

    • Growth measurements relative to untreated controls

    • Adjustment for baseline differences between experimental batches

  • Statistical approach:

    • ANOVA with appropriate post-hoc tests for multiple comparisons

    • Regression analysis for dose-dependent effects

    • Non-parametric tests when data violate normality assumptions

Following this controlled experimental approach, researchers can confidently attribute any observed antagonistic effects to the specific activity of RBAM_008830 rather than to experimental artifacts or non-specific effects.

How does RBAM_008830 contribute to the antimicrobial properties of Bacillus amyloliquefaciens?

While the specific contribution of RBAM_008830 to the antimicrobial properties of B. amyloliquefaciens has not been fully elucidated in the provided search results, we can propose a methodological framework for investigating this question based on known antimicrobial mechanisms in related B. amyloliquefaciens strains:

Potential mechanisms and investigative approaches:

  • Direct antimicrobial activity:

    • Hypothesis: RBAM_008830 may function as part of antimicrobial peptide production or secretion systems.

    • Approach: Compare the ability of wild-type and RBAM_008830 knockout strains to inhibit fungal growth in plate confrontation assays similar to those performed with BA-4 .

    • Analysis: Quantify inhibition zones and examine fungal hyphae morphology for abnormalities characteristic of Bacillus antagonism, such as increased branching, shortened morphology, and thin deformation .

  • Secondary metabolite production:

    • Hypothesis: RBAM_008830 may regulate the synthesis of antimicrobial compounds.

    • Approach: Analyze the production of known antifungal lipopeptides (surfactin, bacillomycin, fengycin) and polyketides in wild-type versus knockout strains using HPLC-MS .

    • Analysis: Correlate metabolite profiles with antagonistic activity and identify compounds affected by RBAM_008830 expression.

  • Regulatory function:

    • Hypothesis: RBAM_008830 may participate in regulatory networks controlling antimicrobial responses.

    • Approach: Perform transcriptomic analysis comparing wild-type and knockout strains under conditions that induce antimicrobial activity.

    • Analysis: Identify differentially expressed gene clusters, particularly those involved in the synthesis of cyclic lipopeptides and other secondary metabolites .

  • Enzyme production or regulation:

    • Hypothesis: RBAM_008830 may influence the production of lytic enzymes that disrupt fungal cell walls.

    • Approach: Compare the production and activity of proteases, cellulases, and chitinases in wild-type and knockout strains.

    • Analysis: Correlate enzyme activity with antagonistic effects and examine specific enzymatic pathways affected by RBAM_008830 .

  • Siderophore involvement:

    • Hypothesis: RBAM_008830 may contribute to the production or function of siderophores, which can inhibit pathogen growth through iron chelation.

    • Approach: Measure siderophore production using chrome azurol S (CAS) assay in wild-type and knockout strains.

    • Analysis: Assess the impact of iron availability on antagonistic activity and siderophore production .

By systematically investigating these potential mechanisms, researchers can elucidate the specific contribution of RBAM_008830 to the well-documented antimicrobial properties of B. amyloliquefaciens strains.

What analytical techniques are most suitable for characterizing the interactions between RBAM_008830 and fungal pathogens?

To comprehensively characterize the interactions between RBAM_008830 and fungal pathogens such as Fusarium species, researchers should employ multiple complementary analytical techniques:

1. Microscopy-based techniques:

  • Scanning electron microscopy (SEM): Visualize morphological changes in fungal hyphae after exposure to RBAM_008830, similar to the observations reported for B. amyloliquefaciens BA-4 .

  • Transmission electron microscopy (TEM): Examine ultrastructural changes in fungal cell walls and internal structures following treatment.

  • Confocal microscopy with fluorescently labeled proteins: Track the localization of RBAM_008830 during interaction with fungal cells and assess co-localization with specific fungal structures.

  • Atomic force microscopy (AFM): Measure changes in mechanical properties of fungal cell walls after protein treatment.

2. Biochemical interaction assays:

  • Co-immunoprecipitation: Identify fungal proteins that directly interact with RBAM_008830.

  • Surface plasmon resonance (SPR): Determine binding kinetics and affinity between RBAM_008830 and fungal cell wall components.

  • Enzyme-linked immunosorbent assay (ELISA): Quantify binding of RBAM_008830 to fungal targets.

  • Cross-linking followed by mass spectrometry: Identify specific amino acid residues involved in protein-protein interactions.

3. Functional assays:

  • Growth inhibition assays: Quantify the effect of RBAM_008830 on fungal growth parameters under varying conditions.

  • Spore germination assays: Assess the impact of RBAM_008830 on spore viability and germination efficiency .

  • Cell wall integrity assays: Measure changes in chitin content, cell wall permeability, and osmotic sensitivity following treatment.

  • Enzyme activity assays: Determine if RBAM_008830 affects the activity of key fungal enzymes involved in pathogenicity.

4. Molecular and 'omics' approaches:

  • RNA-Seq: Profile transcriptional responses in fungal pathogens exposed to RBAM_008830.

  • Proteomics: Identify changes in fungal protein expression patterns following treatment.

  • Metabolomics: Detect alterations in fungal metabolic pathways in response to RBAM_008830.

  • CRISPR-Cas9 screens: Identify fungal genes that mediate sensitivity or resistance to RBAM_008830.

5. In situ visualization techniques:

  • Immunogold labeling: Precisely localize RBAM_008830 binding sites on fungal structures using gold-conjugated antibodies.

  • Fluorescence recovery after photobleaching (FRAP): Measure the dynamics of protein interactions at the bacterial-fungal interface.

  • Bimolecular fluorescence complementation (BiFC): Visualize protein-protein interactions in living cells.

By integrating data from multiple analytical approaches, researchers can develop a comprehensive understanding of how RBAM_008830 interacts with fungal pathogens and contributes to the antagonistic properties observed in B. amyloliquefaciens strains.

How can researchers effectively measure the expression levels of RBAM_008830 in different experimental conditions?

To accurately quantify RBAM_008830 expression under various experimental conditions, researchers should implement a multi-layered approach combining nucleic acid and protein-based detection methods:

RNA-level expression analysis:

  • Quantitative reverse transcription PCR (RT-qPCR):

    • Design primers specific to RBAM_008830 with efficiency testing

    • Select appropriate reference genes for normalization (multiple reference genes recommended)

    • Use the 2^(-ΔΔCt) method for relative quantification

    • Include no-template and no-RT controls

  • RNA-Seq:

    • Perform global transcriptome analysis under different conditions

    • Calculate normalized read counts (FPKM/TPM) for RBAM_008830

    • Identify co-expressed genes for pathway analysis

    • Validate key findings with RT-qPCR

  • Northern blotting:

    • Useful for confirming transcript size and stability

    • Design specific probes for RBAM_008830

    • Include positive controls and size markers

Protein-level expression analysis:

  • Western blotting:

    • Generate specific antibodies against RBAM_008830 or use anti-His antibodies for recombinant protein

    • Include appropriate loading controls

    • Perform quantitative analysis with standard curves

    • Use purified recombinant protein as a positive control

  • Enzyme-linked immunosorbent assay (ELISA):

    • Develop sandwich ELISA for quantitative protein measurement

    • Generate standard curves using purified recombinant protein

    • Test specificity with appropriate controls

  • Mass spectrometry-based proteomics:

    • Use targeted approaches such as selected reaction monitoring (SRM)

    • Identify unique peptides for RBAM_008830 quantification

    • Include isotopically labeled standards for absolute quantification

    • Integrate with global proteomics data for pathway analysis

In situ expression analysis:

  • Immunohistochemistry/Immunofluorescence:

    • Visualize protein localization in bacterial cells

    • Use controls to validate antibody specificity

    • Combine with fluorescent markers for co-localization studies

  • Reporter gene assays:

    • Construct transcriptional fusions (RBAM_008830 promoter with reporter genes)

    • Measure reporter activity under different conditions

    • Include positive and negative controls for reporter function

Experimental conditions to investigate:

  • Growth phase-dependent expression:

    • Sample at different time points during bacterial growth

    • Correlate expression with growth parameters

  • Environmental stress responses:

    • Nutrient limitation (carbon, nitrogen, phosphorus)

    • Temperature and pH variations

    • Oxidative stress

  • Co-culture conditions:

    • Expression in the presence of fungal pathogens

    • Time-course analysis during antagonistic interactions

  • Plant rhizosphere simulation:

    • Growth in plant root exudates

    • Soil-mimicking conditions

This comprehensive approach enables researchers to robustly quantify RBAM_008830 expression across various experimental conditions, providing insights into its regulation and potential functional roles in B. amyloliquefaciens.

What statistical approaches are recommended for analyzing RBAM_008830 protein interaction data?

When analyzing protein interaction data for RBAM_008830, researchers should employ robust statistical methods that account for experimental variability and enable confident interpretation of results:

1. Descriptive statistics and data visualization:

2. Hypothesis testing for comparative studies:

  • Parametric tests:

    • Student's t-test for comparing two conditions (paired or unpaired as appropriate)

    • ANOVA with post-hoc tests (Tukey's HSD, Bonferroni) for multiple comparisons

    • Repeated measures ANOVA for time-course experiments

  • Non-parametric alternatives:

    • Mann-Whitney U test (two groups)

    • Kruskal-Wallis test with Dunn's post-hoc test (multiple groups)

    • Friedman test for repeated measures

3. Regression analysis for dose-response relationships:

  • Linear regression: For analyzing linear relationships between protein concentration and response variables

  • Non-linear regression: For fitting dose-response curves to determine parameters such as EC50, IC50, or Kd values

  • Mixed-effects models: To account for both fixed and random effects in experimental design

4. Multivariate statistical approaches:

  • Principal Component Analysis (PCA): Reduce dimensionality and identify patterns in complex datasets

  • Cluster analysis: Group similar experimental conditions or proteins based on interaction profiles

  • MANOVA: Test differences across multiple dependent variables simultaneously

5. Specialized analyses for specific interaction data:

  • For binding kinetics data:

    • Global fitting of association/dissociation curves

    • Statistical comparison of rate constants (kon, koff) and equilibrium constants (KD)

    • Bootstrap analysis to estimate parameter confidence intervals

  • For structural interaction data:

    • Statistical significance in difference distance matrices

    • Hierarchical clustering of structural conformations

    • Statistical assessment of docking poses

6. Statistical power and sample size considerations:

7. Recommended statistical software packages:

  • R with Bioconductor: Extensive packages for biological data analysis

  • GraphPad Prism: User-friendly interface with comprehensive statistical tools

  • SPSS or SAS: Robust platforms for complex statistical analyses

  • Python with SciPy, NumPy, and Pandas: Flexible programming environment for custom analyses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.