Recombinant Bacillus amyloliquefaciens UPF0344 protein RBAM_010920 (RBAM_010920)

Shipped with Ice Packs
In Stock

Description

Introduction to RBAM_010920 Protein

RBAM_010920 is classified as an UPF0344 family protein originally identified in Bacillus amyloliquefaciens strain FZB42, though current taxonomic classifications in product specifications often list the species as Bacillus velezensis . This discrepancy likely reflects ongoing taxonomic revisions within the Bacillus genus. The protein consists of 118 amino acids and is available commercially as a recombinant protein with an N-terminal histidine tag expressed in E. coli expression systems . The protein belongs to the UPF0344 protein family, a group of uncharacterized proteins with conserved domains but largely unknown functions.

The UniProt identification number for this protein is A7Z380, which provides a standardized reference for this protein in proteomics databases . As a recombinant product, RBAM_010920 is primarily used in research settings for various biochemical and molecular biology applications, though its specific biological function remains to be fully characterized based on available data.

Taxonomic Context and Nomenclature

While commercially labeled as a Bacillus amyloliquefaciens protein, current product specifications list Bacillus velezensis as the source species . This apparent discrepancy reflects recent taxonomic revisions within the Bacillus genus, particularly among closely related species in the B. subtilis group. The strain FZB42 was originally classified as B. amyloliquefaciens but may have been reclassified as B. velezensis based on more recent genomic analyses. Despite this taxonomic update, the historical nomenclature remains in the protein name for consistency with earlier literature and database entries.

Production and Recombinant Expression Systems

RBAM_010920 is commercially available as a recombinant protein produced in heterologous expression systems. The production method involves genetic engineering techniques to express the bacterial protein in E. coli, which offers advantages for large-scale protein production and purification.

Expression Systems and Methods

The recombinant RBAM_010920 protein is expressed in E. coli expression systems, a common approach for producing bacterial proteins in research quantities . The gene encoding the protein is cloned into appropriate expression vectors that enable high-level production in E. coli hosts. The recombinant protein includes an N-terminal histidine tag (His-tag), which facilitates purification using affinity chromatography techniques.

Purification and Quality Control

Following expression, the recombinant protein undergoes purification processes to achieve high purity levels. According to product specifications, the commercially available RBAM_010920 achieves a purity greater than 90% as determined by SDS-PAGE analysis . This level of purity is suitable for most research applications including antibody production, protein-protein interaction studies, and structural analyses.

Table 2: Production and Purification Specifications

ParameterSpecification
Expression HostE. coli
Tag SystemN-terminal His-tag
Protein LengthFull Length (1-118 amino acids)
Physical FormLyophilized powder
Purity>90% (SDS-PAGE verified)
Production ScaleResearch quantities (≥50 μg)

Physical Properties and Handling Recommendations

The recombinant RBAM_010920 protein has specific storage and handling requirements to maintain its stability and activity. Proper storage conditions and reconstitution methods are critical for preserving protein integrity for research applications.

Reconstitution and Buffer Compatibility

The lyophilized protein is provided in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . Alternatively, some preparations use a Tris-based buffer with 50% glycerol optimized for protein stability . For reconstitution, it is recommended that the vial be briefly centrifuged before opening to bring contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

Table 3: Storage and Handling Recommendations

ParameterRecommendation
Long-term Storage-20°C to -80°C
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Alternative BufferTris-based buffer with 50% glycerol
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)
Working Storage4°C for up to one week
Extended StorageAdd glycerol to 50% final concentration
Important NotesAvoid repeated freeze-thaw cycles; Aliquoting recommended

Product Identification and Ordering

The recombinant protein is available through suppliers with specific catalog numbers for ordering. Currently identified product codes include RFL26112BF from Creative BioMart and CSB-CF423942BQD for ELISA applications . These commercial sources typically offer the protein in research quantities (≥50 μg) with options for larger amounts upon request .

Quality Assurance and Documentation

Commercial preparations of RBAM_010920 include documentation of quality control measures, such as SDS-PAGE analysis confirming purity levels exceeding 90% . While not explicitly stated in the search results, standard quality control for recombinant proteins typically includes verification of molecular weight, verification of tag presence, and batch-to-batch consistency checks.

Table 4: Commercial Product Specifications

ParameterSpecification
Catalog NumbersRFL26112BF (Creative BioMart); CSB-CF423942BQD (ELISA version)
Standard Quantity50 μg (other quantities available upon request)
Species DesignationBacillus velezensis (in specifications) / Bacillus amyloliquefaciens (in product name)
Tag InformationHis-tagged (N-terminal) or "determined during production process"
FormLyophilized powder
Not For Human ConsumptionExplicitly stated in product information

Potential Functions and Research Applications

While the specific biological function of RBAM_010920 remains largely uncharacterized, structural features and its classification as a UPF0344 family protein provide insights into potential roles and research applications.

Predicted Functions Based on Sequence Analysis

The presence of charged amino acid clusters (particularly lysine residues) interspersed between hydrophobic regions may indicate interaction points with other proteins or membrane components. Such structural features are consistent with proteins involved in membrane organization, small molecule transport, or signal transduction across the bacterial membrane.

Research Applications

The recombinant RBAM_010920 protein has several potential research applications:

  1. Structural studies: The purified protein can be used for X-ray crystallography or NMR studies to determine its three-dimensional structure.

  2. Antibody production: As a purified antigen, it can be used to generate specific antibodies for detection and localization studies.

  3. Protein-protein interaction studies: The tagged recombinant protein facilitates pull-down assays to identify potential binding partners.

  4. Functional characterization: In vitro assays to determine biological activity and substrate specificity.

  5. Comparative proteomics: Studies comparing UPF0344 family proteins across different bacterial species.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate requests when possible.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
RBAM_010920; UPF0344 protein RBAM_010920
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42) (Bacillus amyloliquefaciens subsp. plantarum)
Target Names
RBAM_010920
Target Protein Sequence
MTHWHITSWVVALILVFVSYGLYGSGKAKGAKITHMILRLFYIIIILTGAELFVRFANWN GEYAGKMLLGIITIGLMEMLVIRKKKGKSTGGLWIGFIIVLVLTVLLGLHLPIGFHVF
Uniprot No.

Target Background

Database Links
Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for RBAM_010920 production?

For recombinant production of RBAM_010920, E. coli has been successfully employed as an expression host . When designing expression systems for this protein, researchers should consider:

  • Vector selection: pET series vectors with T7 promoters are commonly used for His-tagged recombinant proteins.

  • E. coli strain optimization: BL21(DE3) and its derivatives are recommended for membrane-associated proteins.

  • Induction conditions: IPTG concentration (typically 0.1-1.0 mM), temperature (often lowered to 16-25°C for membrane proteins), and duration (4-16 hours) should be optimized.

  • Solubilization strategies: Since RBAM_010920 appears to have membrane-associated properties, solubilization using mild detergents may be necessary during purification.

When expressing this protein, researchers should conduct small-scale expression trials varying these parameters to determine optimal conditions before scaling up. Western blotting using anti-His antibodies can confirm expression before proceeding to larger-scale purification protocols.

What are the recommended storage and handling conditions for purified RBAM_010920?

Purified recombinant RBAM_010920 is typically provided as a lyophilized powder and requires careful storage and handling to maintain activity . The recommended protocol includes:

  • Initial handling: Briefly centrifuge the vial before opening to bring contents to the bottom.

  • Reconstitution: Dissolve in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Long-term storage: Add glycerol to a final concentration of 5-50% (50% is standard) and aliquot for long-term storage at -20°C/-80°C .

  • Working aliquots: Store at 4°C for up to one week.

  • Avoid freeze-thaw cycles: Repeated freezing and thawing significantly reduces protein stability and activity.

The protein is typically stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 . Trehalose serves as a cryoprotectant that helps maintain protein structure during freeze-thaw cycles. For experimental work requiring alternative buffers, researchers should evaluate buffer exchange methods that minimize protein loss and denaturation.

What structural features might contribute to RBAM_010920 function?

Although detailed structural studies of RBAM_010920 have not been extensively reported, sequence analysis reveals several key features that may contribute to its function:

  • Transmembrane regions: The amino acid sequence contains stretches of hydrophobic residues (e.g., "VVALILVFVSYGLYGSGKAKGAKITH") that are characteristic of transmembrane domains .

  • Charged residues: The presence of positively charged residues (K and R) may be important for protein-protein interactions or substrate binding.

  • Conserved motifs: Analysis of the UPF0344 family reveals conserved sequence motifs, including "GAKITH" and "FVRFANWN", which may be critical for function.

To fully characterize the structure-function relationship, researchers should consider employing:

  • Circular dichroism spectroscopy to evaluate secondary structure composition

  • Site-directed mutagenesis of conserved residues to identify functional domains

  • Structural prediction using AlphaFold or similar tools to generate hypotheses about functional regions

  • Membrane topology mapping using reporter fusion proteins or protease protection assays

These approaches would help establish the orientation of the protein within the membrane and identify regions exposed to either side of the membrane, providing crucial insights into potential functional mechanisms.

How does RBAM_010920 relate to the biocontrol properties of B. amyloliquefaciens?

While the specific role of RBAM_010920 in biocontrol has not been directly established, B. amyloliquefaciens strains are known for their antagonistic activities against various plant pathogens . The strain BA-4, for example, demonstrates strong antagonistic effects against Fusarium pathogens associated with apple replant disease (ARD) .

Several mechanisms contribute to the biocontrol properties of B. amyloliquefaciens:

  • Production of antimicrobial compounds: B. amyloliquefaciens synthesizes various antimicrobial peptides, lipopeptides (surfactin, bacillomycin, fengycin), and polyketides that inhibit pathogen growth .

  • Lytic enzyme secretion: Production of enzymes like protease and cellulase that can disrupt pathogen cell walls .

  • Siderophore production: Iron-chelating compounds that limit pathogen access to essential nutrients .

To investigate potential roles of RBAM_010920 in these mechanisms, researchers could:

  • Generate knockout mutants lacking the RBAM_010920 gene and assess changes in biocontrol efficacy

  • Perform transcriptomic analysis to determine if RBAM_010920 expression correlates with biocontrol activity under various conditions

  • Use protein localization techniques to determine if RBAM_010920 is associated with secretion mechanisms for antimicrobial compounds

These approaches would help establish whether RBAM_010920 contributes directly to biocontrol or plays a supporting role in bacterial physiology during antagonistic interactions.

What experimental techniques are most appropriate for studying protein-protein interactions involving RBAM_010920?

As a putative membrane protein, studying RBAM_010920 interactions requires specialized techniques suitable for hydrophobic proteins. The following methods are recommended:

  • Co-immunoprecipitation with membrane-compatible detergents:

    • Use mild detergents (DDM, CHAPS, or digitonin) at concentrations just above their critical micelle concentration

    • Employ anti-His antibodies for selective precipitation of the tagged RBAM_010920

    • Analyze co-precipitated proteins by mass spectrometry

  • Bacterial two-hybrid systems:

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system is particularly suitable for membrane proteins

    • Split-ubiquitin yeast two-hybrid can also be adapted for bacterial membrane proteins

  • Crosslinking coupled with mass spectrometry:

    • Use membrane-permeable crosslinkers like DSP or formaldehyde

    • Solubilize complexes and purify via the His-tag

    • Identify crosslinked partners through LC-MS/MS analysis

  • Fluorescence-based approaches:

    • FRET (Förster Resonance Energy Transfer) using fluorescent protein fusions

    • BiFC (Bimolecular Fluorescence Complementation) to visualize protein interactions in vivo

Each method has particular strengths and limitations. For initial screenings, co-immunoprecipitation followed by mass spectrometry offers a broad approach to identify potential interaction partners. Validation should then proceed with more specific techniques like bacterial two-hybrid or FRET assays to confirm direct interactions.

What is the recommended protocol for purification of recombinant His-tagged RBAM_010920?

The purification of His-tagged RBAM_010920 requires a protocol optimized for membrane-associated proteins. The following step-by-step procedure is recommended:

  • Cell lysis:

    • Resuspend E. coli expressing RBAM_010920 in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, protease inhibitors)

    • Disrupt cells using sonication or pressure-based methods (French press)

    • Add detergent (0.5-1% n-dodecyl β-D-maltoside or similar) to solubilize membrane proteins

    • Centrifuge at 20,000 × g for 30 minutes to remove cell debris

  • Immobilized metal affinity chromatography (IMAC):

    • Apply cleared lysate to Ni-NTA agarose pre-equilibrated with binding buffer (same as lysis buffer but with 0.05% detergent)

    • Wash with 20 column volumes of wash buffer (lysis buffer with 20-30 mM imidazole)

    • Elute with elution buffer (lysis buffer with 250-300 mM imidazole)

  • Buffer exchange and concentration:

    • Pool eluted fractions and concentrate using centrifugal filter units (10 kDa cutoff)

    • Exchange buffer to storage buffer (Tris/PBS-based buffer with 6% trehalose, pH 8.0)

  • Quality control:

    • Verify purity by SDS-PAGE (should exceed 90%)

    • Confirm identity by Western blot using anti-His antibodies

    • Optional: Verify protein integrity by mass spectrometry

  • Storage preparation:

    • Add glycerol to 50% final concentration

    • Aliquot and store at -80°C

This protocol typically yields 2-5 mg of purified protein per liter of bacterial culture. Additional purification steps, such as size exclusion chromatography, may be employed if higher purity is required for structural studies or specific biochemical assays.

How can researchers assess the functional activity of RBAM_010920?

Since the specific function of RBAM_010920 remains uncharacterized, assessing its activity requires multiple approaches:

  • Membrane integration assays:

    • Membrane fractionation to confirm localization

    • Protease protection assays to determine topology

    • Liposome reconstitution to assess membrane integration capacity

  • Protein interaction studies:

    • Pull-down assays using the His-tag to identify binding partners

    • Surface plasmon resonance to quantify binding affinities

    • Bacterial two-hybrid screening to identify genetic interaction networks

  • Phenotypic analysis:

    • Knockout or knockdown studies in B. amyloliquefaciens

    • Overexpression phenotypes in native host and heterologous systems

    • Growth phenotypes under various stress conditions (temperature, pH, antibiotics)

  • Comparative genomic analysis:

    • Identification of conserved genomic context across Bacillus species

    • Correlation of presence/absence with specific bacterial phenotypes

    • Prediction of functional associations using tools like STRING database

When reporting activity, researchers should include comprehensive controls:

  • Denatured protein controls to confirm specificity of observed activities

  • Vector-only/empty vector controls for expression studies

  • Wild-type complementation to verify restoration of function in mutants

These approaches collectively provide a framework for elucidating the function of this uncharacterized protein through convergent experimental evidence.

What techniques are available for studying the membrane topology of RBAM_010920?

Understanding the membrane topology of RBAM_010920 is crucial for functional characterization. Several complementary techniques can provide insights into how this protein is oriented within the membrane:

  • Computational prediction methods:

    • TMHMM, HMMTOP, or Phobius for transmembrane domain prediction

    • SignalP for signal peptide identification

    • TOPCONS for consensus topology modeling

  • PhoA and LacZ fusion analysis:

    • Create systematic fusions of alkaline phosphatase (PhoA) or β-galactosidase (LacZ) to various positions in RBAM_010920

    • PhoA is active in the periplasm, while LacZ is active in the cytoplasm

    • Activity pattern across multiple fusion points reveals topology

  • Cysteine accessibility methods:

    • Introduce cysteine residues at various positions

    • Treat intact cells with membrane-impermeable sulfhydryl reagents

    • Determine which cysteines are labeled to identify exposed regions

  • Protease protection assays:

    • Prepare inside-out and right-side-out membrane vesicles

    • Treat with proteases (e.g., trypsin)

    • Identify protected fragments by Western blotting with region-specific antibodies

  • Fluorescence-based approaches:

    • GFP fluorescence as a reporter for cytoplasmic localization

    • Split-GFP complementation to map topology in vivo

A comprehensive topology model would ideally integrate data from multiple approaches. Researchers should report the concordance between different methods and address any discrepancies, as each technique has inherent limitations and biases.

How might RBAM_010920 contribute to bacterial antagonism against fungal pathogens?

While direct evidence linking RBAM_010920 to antifungal activity is not established in the provided data, several hypotheses can be proposed based on the broader context of B. amyloliquefaciens biocontrol mechanisms:

  • Potential involvement in antimicrobial compound transport:

    • As a membrane protein, RBAM_010920 could participate in the secretion of antimicrobial compounds that B. amyloliquefaciens produces against fungal pathogens

    • Membrane transporters are critical for exporting compounds like lipopeptides (surfactin, bacillomycin, fengycin) that disrupt fungal membranes

  • Possible role in siderophore utilization:

    • B. amyloliquefaciens produces siderophores that chelate iron, limiting its availability to pathogens

    • RBAM_010920 might function in siderophore transport or sensing mechanisms

  • Contribution to cell wall interactions:

    • The protein could mediate attachment to fungal surfaces, facilitating the delivery of lytic enzymes

    • It might sense fungal cell wall components, triggering antagonistic responses

To investigate these possibilities, researchers could:

  • Compare expression profiles of RBAM_010920 under conditions with and without fungal pathogens

  • Analyze knockouts for altered production or secretion of antimicrobial compounds

  • Examine localization during bacterial-fungal interactions using fluorescence microscopy

The striking ability of B. amyloliquefaciens BA-4 to inhibit mycelial growth and spore germination of Fusarium pathogens provides a valuable experimental system to investigate the potential contribution of RBAM_010920 to these antagonistic capabilities.

What genomic and transcriptomic approaches would be valuable for studying RBAM_010920 function?

Understanding RBAM_010920 function can be significantly advanced through genomic and transcriptomic analyses:

  • Comparative genomics:

    • Analyze conservation patterns of RBAM_010920 across different Bacillus species

    • Identify synteny (gene neighborhood conservation) patterns that may suggest functional associations

    • Examine evolutionary rate to assess selective pressure (Ka/Ks ratio)

  • Transcriptome profiling:

    • RNA-Seq analysis of B. amyloliquefaciens under various conditions:

      • Growth phases (log, stationary)

      • Nutrient limitations

      • Co-culture with fungal pathogens

      • Exposure to plant root exudates

    • Construct transcriptional regulatory networks to identify co-regulated genes

  • Regulon mapping:

    • ChIP-Seq to identify transcription factors binding near RBAM_010920

    • Promoter analysis to identify potential regulatory motifs

    • Reporter systems to validate regulatory relationships

  • Systems biology integration:

    • Correlate transcriptomic data with metabolomic profiles

    • Integrate with proteomic data to assess post-transcriptional regulation

    • Develop predictive models of RBAM_010920 function based on multi-omics data

Table: Recommended RNA-Seq experimental design for studying RBAM_010920 expression

ConditionReplicatesTime PointsKey Parameters to Monitor
Standard growth3 biological4, 8, 12, 24hGrowth rate, pH
Nutrient limitation3 biological4, 8, 12, 24hCarbon source, nitrogen source
Fungal co-culture3 biological4, 8, 12, 24hDistance from fungal colony
Plant root exudates3 biological4, 8, 12, 24hExudate concentration
Biofilm formation3 biological12, 24, 48, 72hBiofilm architecture

This experimental design would provide comprehensive insights into the conditions that regulate RBAM_010920 expression, offering valuable clues about its physiological function and potential role in bacterial-fungal interactions.

What structural biology approaches would be most informative for characterizing RBAM_010920?

As a membrane protein, RBAM_010920 presents specific challenges for structural characterization. The following approaches are recommended for elucidating its structure:

  • X-ray crystallography:

    • Requires detergent screening to identify optimal solubilization conditions

    • Lipidic cubic phase (LCP) crystallization may be suitable for membrane proteins

    • Molecular replacement using structural homologs can facilitate phase determination

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for high-resolution structure determination

    • Particularly valuable if RBAM_010920 forms larger complexes

    • Sample preparation using nanodiscs or amphipols can maintain native-like environment

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Solution NMR for specific domains or fragments

    • Solid-state NMR for full-length protein in membrane mimetics

    • Can provide dynamics information not available from static methods

  • Integrated computational approaches:

    • AlphaFold2 or RoseTTAFold predictions as starting models

    • Molecular dynamics simulations to assess behavior in membranes

    • Refinement of predicted structures against experimental data

  • EPR spectroscopy:

    • Site-directed spin labeling to probe specific regions

    • DEER (Double Electron-Electron Resonance) to measure distances between domains

    • Particularly valuable for detecting conformational changes

What are common challenges in expressing recombinant RBAM_010920 and how can they be addressed?

Expression of membrane proteins like RBAM_010920 often presents several challenges. Here are common issues and their solutions:

  • Low expression levels:

    • Problem: Membrane proteins typically express at lower levels than soluble proteins.

    • Solutions:

      • Use strong inducible promoters (T7, tac)

      • Optimize codon usage for E. coli

      • Try specialized E. coli strains (C41/C43, Rosetta)

      • Consider fusion partners (MBP, SUMO) to enhance solubility

      • Lower induction temperature (16-25°C)

  • Protein aggregation/inclusion bodies:

    • Problem: Overexpressed membrane proteins often misfold and aggregate.

    • Solutions:

      • Reduce induction strength (lower IPTG concentration, 0.1-0.5 mM)

      • Include membrane-mimetic detergents in lysis buffer

      • Try refolding protocols from inclusion bodies

      • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

  • Protein degradation:

    • Problem: Unstable proteins may be degraded by host proteases.

    • Solutions:

      • Use protease-deficient strains (BL21)

      • Include protease inhibitors in all buffers

      • Optimize cell lysis conditions (gentler methods)

      • Process samples quickly and maintain cold temperatures

  • Poor solubilization:

    • Problem: Inefficient extraction from membranes.

    • Solutions:

      • Screen multiple detergents (DDM, LDAO, CHAPS)

      • Test detergent concentration series

      • Optimize solubilization time and temperature

      • Consider mild solubilization (longer time, lower detergent)

  • Low purification yield:

    • Problem: Significant loss during purification steps.

    • Solutions:

      • Optimize imidazole concentrations in wash buffers

      • Maintain detergent above CMC throughout purification

      • Use shorter purification schemes to minimize time

      • Consider on-column refolding for proteins in inclusion bodies

A systematic approach to optimization, adjusting one parameter at a time and carefully documenting outcomes, will help identify optimal conditions for RBAM_010920 expression and purification.

How can researchers validate that recombinant RBAM_010920 maintains its native conformation?

Ensuring that recombinant RBAM_010920 retains its native conformation is crucial for functional studies. Several complementary approaches can be used for validation:

  • Circular dichroism (CD) spectroscopy:

    • Far-UV CD (190-250 nm) to assess secondary structure content

    • Compare spectra in different detergents to identify conditions that preserve native folding

    • Thermal denaturation studies to assess protein stability

  • Intrinsic fluorescence spectroscopy:

    • Monitor tryptophan/tyrosine fluorescence emission spectra

    • Changes in emission maxima indicate alterations in local environment

    • Useful for detecting gross conformational changes

  • Limited proteolysis:

    • Well-folded proteins show resistance to proteolytic digestion

    • Compare digestion patterns between different preparation methods

    • Time-course experiments can reveal stable domains

  • Functional assays:

    • If specific binding partners are known, verify interaction capacity

    • Compare activity of different preparations in relevant functional assays

    • Assess complementation of knockout strains in vivo

  • Analytical ultracentrifugation/size exclusion chromatography:

    • Evaluate oligomeric state and homogeneity

    • Detect aggregation or improper assembly

    • Compare elution profiles across different preparations

When validating conformational integrity, researchers should always include appropriate controls:

  • Thermally denatured protein as a negative control

  • Comparison to protein prepared by alternative methods

  • When possible, comparison to the native protein isolated from B. amyloliquefaciens

These approaches collectively provide a robust assessment of whether the recombinant protein maintains a conformation suitable for meaningful functional and structural studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.