Recombinant Bacillus amyloliquefaciens UPF0756 membrane protein RBAM_026200 (RBAM_026200)

Shipped with Ice Packs
In Stock

Description

Genomic and Phylogenetic Context

RBAM_026200 is encoded in Bacillus amyloliquefaciens strains, which exhibit significant genomic plasticity. Comparative analyses of 96 genomes reveal:

  • Phylogenetic Distribution:

    • Clade 1 (23 strains): Primarily food-associated isolates

    • Clade 2 (73 strains): Dominated by plant-associated strains with antimicrobial metabolite genes

While RBAM_026200 itself isn’t directly linked to characterized virulence or antibiotic resistance genes, its genomic neighborhood in clade 2 strains suggests adaptive roles in environmental interactions .

Production and Quality Control

Industrial-scale synthesis employs E. coli expression systems, optimized through:

ParameterProtocol
Expression HostEscherichia coli BL21(DE3)
Tagging SystemN-terminal His-tag for affinity purification
Yield OptimizationGlycerol (50% final concentration) added for long-term storage stability
ValidationMALDI-TOF mass spectrometry and circular dichroism for structural confirmation

Functional Implications and Research Applications

Although functional studies remain preliminary, RBAM_026200’s sequence homology suggests involvement in:

  • Membrane Transport: Conserved motifs align with small-molecule transporters in Bacillus spp.

  • Stress Adaptation: Trehalose-stabilized storage buffers imply relevance to osmotic stress response mechanisms

Current commercial applications focus on:

  • ELISA development for membrane protein quantification

  • Structural biology studies using cryo-EM templates

Challenges and Future Directions

Key knowledge gaps include:

  1. Pathway Associations: No experimentally validated metabolic or signaling pathways

  2. Interaction Partners: Limited data on protein-protein interactions despite yeast two-hybrid screening availability

  3. In Vivo Function: Requires knock-out studies in native Bacillus hosts

Ongoing research prioritizes heterologous expression in Bacillus subtilis to assess functionality under plant rhizosphere conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
RBAM_026200; UPF0756 membrane protein RBAM_026200
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42) (Bacillus amyloliquefaciens subsp. plantarum)
Target Names
RBAM_026200
Target Protein Sequence
MFTQANLFLLLLLAIALVAKNQSLLFAVGFLIVIKAVGLDQKLFPVIQSKGINWGVTVIT IAVLVPIATGDIGFKQLGEAMKSYYAWIALGAGIAVALIAKNGLTLLENDPHITTALVIG TILAVALFGGVAVGPLIGAGIAYLAMQIVKIFTS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant RBAM_026200?

For maintaining protein stability and activity, recombinant RBAM_026200 requires specific storage conditions:

Storage ParameterRecommendationNotes
Long-term storage-20°C/-80°CAliquoting necessary for multiple use
Working aliquots4°CStable for up to one week
Buffer compositionTris-based buffer with 50% glycerolpH 8.0 optimized for this protein
ReconstitutionDeionized sterile waterRecommended concentration: 0.1-1.0 mg/mL
Post-reconstitutionAdd glycerol to 5-50% final concentrationDefault recommendation is 50%

Repeated freeze-thaw cycles should be avoided as they significantly decrease protein stability and activity . When preparing for experimental use, it is recommended to briefly centrifuge the vial prior to opening to bring contents to the bottom .

How can researchers verify the purity of recombinant RBAM_026200?

Methodological approach to verifying protein purity includes:

  • SDS-PAGE analysis: Commercial preparations typically guarantee >90% purity as determined by SDS-PAGE . Researchers should run their own verification gels using reducing conditions.

  • Western blot analysis: Using anti-His antibodies to detect the His-tagged protein. This method not only confirms identity but can reveal degradation products.

  • Size exclusion chromatography (SEC): To assess protein aggregation and oligomeric state.

  • Mass spectrometry: For precise molecular weight determination and confirmation of sequence integrity.

For membrane proteins like RBAM_026200, purity assessment should include analysis of detergent content and potential co-purifying lipids, as these can affect downstream applications.

What expression systems are suitable for RBAM_026200 production?

While the commercial recombinant RBAM_026200 is expressed in E. coli , researchers investigating alternative expression systems should consider:

Expression SystemAdvantagesLimitationsRelevance to RBAM_026200
E. coliHigh yield, rapid growth, economicalLimited post-translational modificationsCurrently used for commercial production
B. amyloliquefaciensNative environment, proper foldingLower yields than E. coliNatural host, developed as expression system for heterologous proteins
B. subtilisWell-established secretion systemProteolytic degradation concernsClose relative to B. amyloliquefaciens
P. pastorisHigher eukaryotic folding machineryLonger production timePotential for complex membrane proteins

B. amyloliquefaciens K11 has been developed as a high-level secretion system for recombinant proteins, with PamyQ-SPaprE identified as the optimal secretory expression cassette . This system could potentially be adapted for homologous expression of RBAM_026200.

What methodologies are most effective for membrane protein solubilization and purification of RBAM_026200?

For membrane proteins like RBAM_026200, successful purification requires careful selection of solubilization and purification strategies:

Methodological approach:

  • Membrane isolation: Differential centrifugation of lysed cells, with washing steps to remove peripheral proteins.

  • Detergent screening: Test multiple detergent classes for optimal solubilization:

Detergent ClassExamplesTypical ConcentrationConsiderations for RBAM_026200
IonicSDS, sodium cholate0.5-2%Harsh, may denature protein
Non-ionicDDM, OG, Triton X-1000.5-2%Milder, preserves structure
ZwitterionicCHAPS, Fos-choline0.1-1%Intermediate harshness
AmphipolsA8-350.01-0.1%Stabilizes in solution
NanodiscsMSP1D1/POPCN/ANative-like environment
  • Affinity chromatography: His-tagged RBAM_026200 can be purified using Ni-NTA or similar matrices, with optimization of imidazole concentration in wash and elution buffers.

  • Size exclusion chromatography: As a polishing step and to assess oligomeric state.

  • Stability optimization: Once purified, protein stability can be enhanced by:

    • Addition of specific lipids

    • Buffer optimization (pH, salt concentration)

    • Addition of stabilizing agents (glycerol, specific substrates)

For RBAM_026200 specifically, its relatively small size (154 amino acids) may make it more amenable to purification than larger membrane proteins, but its hydrophobic nature still presents challenges that require careful optimization.

What approaches can be used to determine the function of the poorly characterized RBAM_026200 protein?

As a UPF0756 family protein with limited functional characterization, several complementary approaches can elucidate RBAM_026200's function:

  • Comparative genomics and bioinformatics:

    • Sequence homology analysis with functionally characterized proteins

    • Gene neighborhood analysis to identify functionally related genes

    • Structural predictions using AlphaFold or similar tools

  • Gene knockout/knockdown studies:

    • CRISPR-Cas9 or similar methods to generate knockout strains

    • Phenotypic characterization under various growth conditions

    • Transcriptomic analysis to identify affected pathways

  • Protein-protein interaction studies:

    • Pull-down assays using His-tagged RBAM_026200

    • Bacterial two-hybrid systems

    • Cross-linking mass spectrometry

  • Localization studies:

    • Fluorescent protein fusions

    • Immunogold electron microscopy

    • Subcellular fractionation

  • Functional assays:

    • Transport assays if suspected to be a transporter

    • Enzymatic activity tests based on bioinformatic predictions

    • Lipid binding assays if involved in membrane organization

Based on other membrane proteins in Bacillus species, potential functions could include transport, signaling, or structural roles in membrane organization .

How can researchers optimize heterologous expression of RBAM_026200?

Optimizing expression requires systematic investigation of multiple parameters:

Methodological approach:

  • Expression vector selection:

    • Promoter strength (constitutive vs. inducible)

    • Copy number (low vs. high)

    • Fusion tags (position and type)

  • Host strain optimization:

Host StrainAdvantagesPotential Application to RBAM_026200
E. coli BL21(DE3)General purpose, high yieldsStandard initial choice
E. coli C41/C43Specialized for membrane proteinsMay improve yield and reduce toxicity
E. coli Lemo21Tunable expression levelFine control for toxic membrane proteins
B. amyloliquefaciens K11Native environment, hyperproducer of extracellular proteinsHomologous expression
  • Expression conditions optimization:

    • Induction parameters (temperature, inducer concentration, timing)

    • Growth media composition

    • Harvest timing

Research has shown that for B. amyloliquefaciens proteins, the PamyQ-SPaprE secretory expression cassette gives the highest enzyme activities in a B. amyloliquefaciens K11 host system . This combination yielded enzyme activities of approximately 13,800 ± 308 U/mL for one test protein, and after knocking out the endogenous neutral protease-encoding gene Banpr, enzyme activities further improved by 25.4% . Similar strategies could be adapted for RBAM_026200 expression.

What crystallization strategies are appropriate for membrane proteins like RBAM_026200?

Membrane protein crystallization remains challenging but several approaches have proven successful:

  • Detergent-based crystallization:

    • Systematic screening of detergent types and concentrations

    • Vapor diffusion (hanging or sitting drop)

    • Bicelle method

    • Lipidic cubic phase (LCP)

  • Crystal screening strategies:

MethodDescriptionAdvantages for RBAM_026200
Sparse matrix screensCommercial kits with diverse crystallization conditionsGood starting point
Grid screensSystematic variation of pH, salt, precipitantRefines promising conditions
Additive screensSmall molecules that promote crystal contactsCan overcome packing issues
Lipid screeningVarious lipids added to stabilize proteinMimics native environment
Antibody-mediatedFab fragments to create crystal contactsIncreases hydrophilic surface
  • Alternative structural determination methods:

    • Cryo-electron microscopy (for larger complexes)

    • NMR (feasible for RBAM_026200 due to its smaller size)

    • X-ray free electron laser (XFEL) for microcrystals

Given RBAM_026200's relatively small size (154 amino acids), it may be a good candidate for NMR studies if crystallization proves challenging, particularly if expressed in isotope-labeled media.

How can structural bioinformatics inform experimental design for RBAM_026200 characterization?

Bioinformatic analysis can guide experimental approaches:

  • Transmembrane domain prediction:

    • TMHMM, HMMTOP, and Phobius predict potentially 4-5 transmembrane regions

    • These predictions inform construct design for expression optimization

  • Homology modeling:

    • While UPF0756 proteins lack solved structures, related membrane proteins can provide templates

    • Models can suggest regions critical for function or stability

  • Sequence conservation analysis:

Conservation LevelAmino Acid Positions (predicted)Potential Functional Significance
Highly conserved25-40, 65-80, 110-125Functional sites, substrate binding
Moderately conserved10-20, 45-60, 90-105Structural importance
Variable1-9, 130-154Less critical or species-specific regions
  • Functional domain prediction:

    • Conserved domain databases may identify functional modules

    • Protein family (Pfam) classification provides functional insights

  • Molecular dynamics simulations:

    • Behavior in lipid bilayers

    • Potential conformational changes

    • Identification of stable regions for construct design

These bioinformatic analyses create testable hypotheses about protein function and structure that can be systematically investigated through the experimental approaches outlined in previous sections.

What are the most common challenges when working with RBAM_026200 and how can they be addressed?

Membrane proteins like RBAM_026200 present several experimental challenges:

  • Low expression yields:

    • Solution: Test multiple expression systems (E. coli strains, B. amyloliquefaciens)

    • Optimize induction conditions (temperature, duration, inducer concentration)

    • Consider autoinduction media to reduce toxicity

  • Protein misfolding:

    • Solution: Reduce expression rate (lower temperature, weaker promoter)

    • Co-express with chaperones (GroEL/ES, DnaK/J)

    • Express in native-like host (B. amyloliquefaciens)

  • Aggregation during purification:

    • Solution: Screen multiple detergents systematically

    • Include glycerol (5-10%) in buffers

    • Maintain low temperature throughout purification

    • Consider amphipols or nanodiscs for stabilization

  • Functional assay development:

    • Solution: Based on bioinformatic predictions, test multiple potential activities

    • Compare activity in different membrane mimetics (detergents vs. liposomes)

    • Perform activity assays with potential binding partners

  • Limited stability:

    • Solution: Store in multiple small aliquots to avoid freeze-thaw cycles

    • Optimize buffer conditions (pH, salt, additives)

    • Consider lyophilization with appropriate excipients

How can researchers reconcile contradictory data on RBAM_026200 structure or function?

When faced with contradictory experimental results:

  • Methodological reconciliation approach:

    • Systematically compare experimental conditions between studies

    • Identify variables that might explain differences (pH, temperature, detergents)

    • Perform side-by-side experiments controlling for key variables

  • Consider multiple functional states:

    • Membrane proteins often exist in multiple conformational states

    • Apparent contradictions may reflect different functional states

    • Design experiments to trap specific conformational states

  • Validate with orthogonal methods:

    • If structural data conflicts, use multiple techniques (X-ray, NMR, cryo-EM)

    • For functional data, use complementary assays measuring different aspects of the same function

    • Consider in vivo validation of in vitro findings

  • Account for environmental effects:

    • Membrane composition can dramatically affect protein behavior

    • Test function in different lipid environments

    • Consider native vs. recombinant protein differences

  • Statistical analysis:

    • Ensure sufficient replication to power statistical comparisons

    • Use appropriate statistical tests for the data type

    • Consider meta-analysis approaches for contradictory literature

What control experiments are critical when studying RBAM_026200?

Rigorous experimental design requires appropriate controls:

  • Negative controls:

    • Empty vector/host strain (for expression studies)

    • Heat-denatured protein (for functional assays)

    • Non-specific substrate analogs (for binding/activity studies)

  • Positive controls:

    • Well-characterized membrane protein from the same host

    • Known substrate/interactor (if available from homology predictions)

    • Validated antibody targets for localization studies

  • Technical controls:

    • Multiple purification batches to assess reproducibility

    • Different tag positions (N- vs. C-terminal) to assess impact on function

    • Detergent-only controls for crystallization and functional assays

  • Specificity controls:

    • Site-directed mutants of predicted functional residues

    • Specificity analysis with structurally related substrates

    • Competition assays with unlabeled substrate

These controls help distinguish genuine biological effects from technical artifacts, particularly important for challenging membrane proteins like RBAM_026200.

How might RBAM_026200 be utilized in biotechnological applications?

Based on properties of other Bacillus membrane proteins, potential applications include:

  • Bioremediation:

    • If RBAM_026200 has transport or enzymatic functions, it might be engineered for environmental applications

    • B. amyloliquefaciens laccase has been shown to degrade dyes at elevated temperatures and varying pH conditions

    • Similar engineered applications could be developed if RBAM_026200 shows catalytic activity

  • Membrane protein expression platform:

    • B. amyloliquefaciens has been developed as an efficient expression system

    • Knowledge gained from RBAM_026200 expression could improve platforms for other membrane proteins

  • Biosensors:

    • If substrate binding induces conformational changes, RBAM_026200 could be engineered as a biosensor component

    • Potential signal transduction applications based on membrane protein function

  • Structural biology model:

    • Small membrane proteins like RBAM_026200 (154 amino acids) can serve as models for understanding larger, more complex systems

    • Method development using this relatively simple protein could advance membrane protein structural biology

What are the emerging techniques that could advance RBAM_026200 research?

The field of membrane protein research is rapidly evolving with new techniques applicable to RBAM_026200:

  • Single-particle cryo-EM:

    • Recent advances allow structure determination of smaller proteins

    • Could be applied to RBAM_026200 complexes with binding partners

  • Native mass spectrometry:

    • Characterizes membrane proteins in detergent micelles or nanodiscs

    • Provides insights into oligomeric state and ligand binding

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps protein dynamics and conformational changes

    • Can identify regions involved in substrate binding

  • Microfludics-based crystallization:

    • High-throughput screening of crystallization conditions

    • Requires minimal protein amounts

  • AlphaFold and other AI-based structure prediction:

    • Increasingly accurate for membrane proteins

    • Can guide experimental design and hypothesis generation

  • Single-molecule techniques:

    • FRET to monitor conformational changes

    • Force spectroscopy to probe mechanical properties

    • Single-channel recordings if RBAM_026200 forms a pore

These emerging techniques could overcome traditional challenges in membrane protein research and accelerate understanding of RBAM_026200 structure and function.

How does the study of RBAM_026200 contribute to broader understanding of bacterial membrane biology?

Research on RBAM_026200 has implications for several fundamental questions:

  • Membrane protein evolution:

    • As part of the UPF0756 family, comparative analysis across species reveals evolutionary patterns

    • May provide insights into functional adaptation of membrane proteins

  • Bacterial physiology:

    • B. amyloliquefaciens is naturally present in soils and can adapt to various environmental conditions

    • Understanding membrane proteins like RBAM_026200 helps explain this adaptability

  • Protein structure-function relationships:

    • Small membrane proteins offer tractable systems to study fundamental principles

    • Insights may apply to more complex eukaryotic membrane proteins

  • Membrane protein biogenesis:

    • Studies of expression, folding, and assembly contribute to understanding how cells build functional membranes

    • May reveal novel quality control mechanisms

  • Methodological advances:

    • Techniques developed for RBAM_026200 could benefit the broader membrane protein field

    • Especially important given that membrane proteins represent ~30% of proteomes but <1% of known structures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.