Recombinant Bacillus anthracis Antiholin-like protein LrgB (lrgB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
lrgB; BAMEG_5736; Antiholin-like protein LrgB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Bacillus anthracis (strain CDC 684 / NRRL 3495)
Target Names
lrgB
Target Protein Sequence
MASTMTPYFGIVVSLIAYGIGTLLFKHSKGFFLFTPLFVAMVLGIVFLKVGNFTFEEYNT GGKMISFFLEPATIAFAIPLYKQVDKLKKYWWQILSAIVVGSICSVIVVFIVAKAIGLDT AVMNSMLPQAATTAIALPISESIGGIPAITSFAVIFNAVIVYALGALFLKTFRVKHPIAK GLALGTAGHALGVAVGIEMGEVEAAMASIAVTVVGVVTVVVIPMFMPFIG
Uniprot No.

Target Background

Function
This protein inhibits the expression or activity of extracellular murein hydrolases by interacting, potentially with LrgA, with the holin-like protein CidA. The LrgAB and CidA proteins may influence the proton motive force of the membrane. This protein might be involved in programmed cell death (PCD), possibly triggering PCD in response to antibiotics and environmental stresses.
Database Links
Protein Families
CidB/LrgB family, LrgB subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus anthracis Antiholin-like protein LrgB and what is its role in bacterial physiology?

The LrgB protein in Bacillus anthracis is characterized as an antiholin-like protein that functions within the lrgAB operon, which is involved in the regulation of cell death and lysis. Similar to its homologue in Staphylococcus aureus, B. anthracis LrgB appears to participate in a regulatory network that controls murein hydrolase activity . Murein hydrolases are enzymes that degrade peptidoglycan, and their activity must be tightly regulated to prevent premature cell lysis.

The lrgAB operon is believed to encode proteins that counteract the activity of the cidAB operon, which promotes cell lysis. This regulatory system represents a form of programmed cell death in bacteria, with LrgB specifically functioning as part of the inhibitory mechanism against uncontrolled cell wall degradation.

How is the lrgB gene organized within the B. anthracis genome?

The lrgB gene in B. anthracis is co-transcribed with lrgA as part of the lrgAB operon. Northern blot analyses have confirmed that these genes produce a single 1.2 kb transcript, indicating their organization within a bicistronic operon structure . Unlike S. aureus, which produces two overlapping lrgAB transcripts, B. anthracis appears to generate only a single transcript type.

The genomic context of the lrgAB operon is significant for its regulation, particularly in relation to the cidAB operon. Unlike the cidABC operon in S. aureus, the B. anthracis cid operon does not contain a cidC gene encoding pyruvate oxidase, which represents an important difference in the regulatory networks between these species .

What experimental methodologies are recommended for expressing recombinant B. anthracis LrgB?

For recombinant expression of B. anthracis LrgB, researchers typically employ the following protocol:

  • Gene amplification: PCR amplification of the lrgB gene from B. anthracis genomic DNA using specific primers containing appropriate restriction sites.

  • Cloning strategy: Insertion of the amplified gene into expression vectors such as pET series (particularly pET32a which provides a thioredoxin fusion tag for improved solubility).

  • Expression system: Transformation into E. coli expression strains like BL21(DE3), with expression typically induced using IPTG (0.1-1mM) at mid-log phase.

  • Purification approach: Initial purification via affinity chromatography (Ni-NTA for His-tagged constructs), followed by ion exchange chromatography using SP Sepharose columns with gradients of 0-1M NaCl for improved purity .

  • Protein verification: SDS-PAGE and immunoblotting to confirm identity and purity of the recombinant protein.

For improved stability and therapeutic applications, site-directed mutagenesis to introduce specific cysteine residues for pegylation may be considered, as demonstrated with other B. anthracis proteins .

How is expression of the lrgAB operon regulated in B. anthracis?

The regulation of lrgAB expression in B. anthracis involves a complex network influenced by multiple factors:

CidR-dependent regulation: The transcription of lrgAB is significantly influenced by CidR, a LysR-type transcriptional regulator (LTTR). Northern blot analyses have shown that lrgAB transcription is dramatically reduced in cidR mutant strains during lag phase (2 hours), indicating that CidR positively regulates lrgAB expression .

Glucose-dependent regulation: Unlike in S. aureus, B. anthracis lrgAB exhibits a distinct glucose-dependent regulation pattern. In early exponential phase (4 hours), lrgAB expression in the cidR mutant occurs in the absence of glucose but is suppressed in the presence of glucose .

Temporal expression pattern: Transcription of lrgAB in wild-type B. anthracis is most abundant during lag to early exponential phase (2-4 hours) in both the presence and absence of glucose .

Dual regulatory mechanisms: Evidence suggests that B. anthracis lrgAB is regulated by at least two different mechanisms—one dependent on CidR and another that is CidR-independent but glucose-dependent .

This regulatory pattern differs significantly from that observed in S. aureus, highlighting the species-specific adaptations of the Cid/Lrg system across different bacterial lineages.

What is the relationship between LrgB and S-layer proteins in B. anthracis?

An unexpected finding in B. anthracis research revealed an intriguing connection between the Cid/Lrg regulatory system and S-layer proteins:

  • Murein hydrolase activity: Studies of the cidR mutant in B. anthracis revealed that the predominant murein hydrolase affected was an 85 kDa protein identified as Sap, a primary constituent of the S-layer .

  • Transcriptional impact: The cidR mutation caused reduced transcription of genes encoding both S-layer proteins Sap and EA1, as well as CsaB, which is involved in attaching S-layer proteins to the cell wall .

  • Novel function identification: Both S-layer proteins Sap and EA1 were confirmed to exhibit murein hydrolase activity when their respective genes were cloned and expressed in E. coli .

This relationship establishes a previously undetected role of S-layer proteins as murein hydrolases and suggests that the Cid/Lrg regulatory system influences not only dedicated murein hydrolases but also multifunctional surface proteins in B. anthracis.

How does the CidR-mediated regulation system in B. anthracis compare to that in other bacterial species?

The CidR-mediated regulation in B. anthracis shows both similarities and significant differences compared to other species, particularly S. aureus:

CharacteristicB. anthracisS. aureusSignificance
CidR functionLTTR family regulator affecting cid/lrg expressionLTTR family regulator affecting cid/lrg expressionConserved regulatory mechanism
cidABC operon structureContains cidAB only (no cidC)Contains cidABC with cidC encoding pyruvate oxidasePotential metabolic differences in cell death regulation
lrgAB transcriptsSingle 1.2 kb transcriptTwo overlapping transcriptsDifferent transcriptional processing
Glucose effect on cidABGlucose-dependent induction independent of cidRAcetic acid-dependent activation via cidRDifferent metabolic integration
lrgAB regulationBoth cidR-dependent and cidR-independent mechanismsPrimarily cidR-dependentMore complex regulatory network in B. anthracis
Impact on murein hydrolasesAffects S-layer proteins Sap and EA1Affects dedicated murein hydrolasesNovel functional relationship in B. anthracis

These differences indicate that while the core components of the Cid/Lrg regulatory system are conserved across species, their integration with cellular metabolism and cell surface structures has diverged significantly .

What potential applications exist for targeting LrgB in B. anthracis control strategies?

Given LrgB's role in cell death and lysis regulation, several potential applications for targeting this protein in B. anthracis control strategies can be considered:

  • Antimicrobial development: Compounds that interfere with LrgB function could potentially disrupt the balance between cell survival and death, leading to premature lysis of B. anthracis cells.

  • Adjunct therapy: LrgB-targeting strategies could complement existing antibiotic treatments by increasing bacterial susceptibility to cell wall-targeting antibiotics.

  • Vaccine development: Recombinant LrgB could potentially serve as a component in vaccine formulations. Similar approaches with other B. anthracis proteins have shown protection in animal models .

  • Diagnostic applications: Antibodies against recombinant LrgB could be utilized in diagnostic assays similar to the latex agglutination tests developed for other B. anthracis proteins .

  • Enhanced immune clearance: Targeting LrgB could potentially make B. anthracis more susceptible to immune cell phagocytosis, similar to how capsule depolymerase promotes phagocytosis and killing by human neutrophils .

What methodological approaches are recommended for studying LrgB-protein interactions?

For investigating protein-protein interactions involving LrgB, researchers should consider the following methodological approaches:

  • Bacterial two-hybrid system: Particularly useful for membrane proteins like LrgB, this technique can identify potential interaction partners in vivo.

  • Co-immunoprecipitation: Using antibodies against LrgB to pull down potential interaction complexes, followed by mass spectrometry analysis.

  • Surface plasmon resonance (SPR): For quantitative analysis of binding kinetics between purified LrgB and candidate interacting proteins.

  • Microscale thermophoresis (MST): A solution-based technique that can detect interactions with minimal protein amounts.

  • Proximity labeling approaches: Methods such as BioID or APEX can identify proteins in close proximity to LrgB in living cells.

  • Crosslinking mass spectrometry: To identify amino acid residues involved in protein-protein interactions.

  • Split-GFP complementation: To visualize potential interactions in live cells.

When examining interactions with peptidoglycan or other cell wall components, additional techniques such as binding assays with purified cell wall fractions or synthetic peptidoglycan fragments should be employed.

What are the current challenges in studying LrgB function in B. anthracis?

Several significant challenges complicate the study of LrgB function in B. anthracis:

  • Protein localization: As a predicted membrane protein, LrgB presents difficulties for structural studies and biochemical characterization.

  • Functional redundancy: Potential overlap with other cell death regulatory systems may mask phenotypes in single-gene deletion studies.

  • Biosafety considerations: Working with B. anthracis requires specialized containment facilities, limiting widespread research.

  • Complex regulatory networks: The intricate relationship between the Cid/Lrg system and other cellular processes, such as S-layer production, complicates mechanistic studies .

  • Species-specific differences: Findings from other bacterial species may not translate directly to B. anthracis given the significant differences observed between B. anthracis and S. aureus regulatory patterns .

  • Limited surveillance data: Poor understanding of the global distribution of B. anthracis strains impacts the assessment of LrgB conservation and function across different isolates .

What recent advances have been made in understanding the structural characteristics of bacterial antiholin-like proteins?

While specific structural data for B. anthracis LrgB remains limited, recent advances in understanding bacterial antiholin-like proteins include:

  • Membrane topology models: Computational predictions and experimental validations suggest LrgB likely contains multiple transmembrane domains that anchor it within the cytoplasmic membrane.

  • Functional domains: Structure-function analyses have begun to identify regions critical for antiholin activity, including potential interaction sites with holins or murein hydrolases.

  • Oligomerization properties: Evidence suggests that LrgB may function as part of a multiprotein complex, potentially including LrgA, to regulate cell lysis.

  • Homology modeling: Based on structural data from related proteins, researchers have developed preliminary models of LrgB's three-dimensional configuration.

  • Site-directed mutagenesis studies: Targeted amino acid substitutions have helped identify residues critical for protein function and stability, similar to approaches used for other B. anthracis proteins where specific sites (e.g., S334C) were identified for modification to improve stability and activity .

How might research on LrgB contribute to broader understanding of bacterial programmed cell death?

Research on B. anthracis LrgB has significant implications for understanding bacterial programmed cell death (PCD):

  • Evolutionary conservation: The presence of lrgAB homologues across diverse bacterial and archaeal species suggests a fundamental role in microbial life cycles .

  • Regulatory network integration: The connection between LrgB, CidR regulation, and metabolic pathways (e.g., glucose metabolism) provides insight into how bacterial PCD responds to environmental cues .

  • Novel functional relationships: The discovery that S-layer proteins in B. anthracis exhibit murein hydrolase activity and are regulated by the same system as LrgB reveals unexpected connections between cell envelope structure and death regulation .

  • Species-specific adaptations: The differences in regulatory mechanisms between B. anthracis and S. aureus highlight how PCD systems have evolved to meet the specific ecological niches of different bacterial species .

  • Therapeutic implications: Understanding how LrgB controls cell death may lead to new antimicrobial strategies that artificially trigger bacterial PCD, potentially addressing the growing challenge of antibiotic resistance.

The continued study of LrgB and the Cid/Lrg system in B. anthracis will contribute to a more comprehensive model of bacterial PCD that accounts for both conserved mechanisms and species-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.