Amino Acid Sequence:
MSSVPASAYLTLAIILFCIGLFGALTKRNTVIVLVCIELMLNAANLNFVAFSKLGLFPNL TGQIFSLFTMAVAAAEAAVGLAILIALYRNRTTVHVDEMDTLKG
Complex I Function: Facilitates electron transfer from NADH to quinone, contributing to proton gradient generation and ATP synthesis .
Metabolic Relevance: Essential for aerobic respiration in B. anthracis, a pathogen requiring efficient energy metabolism during infection .
Enzymatic Studies: Used to investigate the structure-function relationship of bacterial Complex I subunits .
Drug Target Screening: Serves as a potential target for inhibitors disrupting bacterial energy metabolism .
Antigen Characterization: Though not directly linked to virulence, recombinant nuoK may aid in proteomic studies of B. anthracis .
A comparison of Bacillus anthracis nuoK with homologs in other species:
| Species | UniProt ID | Length (aa) | Key Features |
|---|---|---|---|
| Mycobacterium bovis | A1KNF1 | 99 | 90% purity, similar transmembrane topology |
| Escherichia coli | A1ADC7 | Partial | Baculovirus expression, 85% purity |
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, the primary electron acceptor is believed to be menaquinone. The enzyme couples this redox reaction to proton translocation, transporting four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy within a proton gradient.
KEGG: bah:BAMEG_5582
NADH-quinone oxidoreductase subunit K (nuoK) is a component of the respiratory chain complex I in Bacillus anthracis. This protein plays a crucial role in energy metabolism, specifically in oxidative phosphorylation pathways. Complex I (NADH:ubiquinone oxidoreductase) represents the first enzyme in the respiratory electron transport chain, catalyzing electron transfer from NADH to ubiquinone while simultaneously pumping protons across the membrane to generate a proton motive force. The nuoK subunit forms part of the membrane domain of this complex, contributing to proton translocation across the bacterial membrane. Its significance lies in its essential function for bacterial energy production, making it potentially important for B. anthracis survival and pathogenicity under various environmental conditions .
The nuoK protein is a hydrophobic, membrane-embedded subunit characterized by multiple transmembrane helices that anchor it within the bacterial membrane. Although specific structural data for B. anthracis nuoK is limited, comparative analysis with homologous proteins suggests it contains approximately three transmembrane segments with conserved charged residues that participate in the proton translocation pathway. These structural features are essential for maintaining the proton channel architecture within Complex I. The protein likely contains conserved lysine and glutamate residues positioned strategically within the transmembrane domains to facilitate proton movement. These structural characteristics directly relate to nuoK's primary function of contributing to the proton-pumping mechanism during electron transfer, which ultimately drives ATP synthesis through the generation of proton motive force across the bacterial membrane .
Comparative genomic analysis reveals both conservation and divergence in nuoK across bacterial pathogens. The B. anthracis nuoK protein maintains core structural elements common to respiratory complex I subunits, but exhibits sequence variations in key regions that may reflect adaptation to the organism's specific metabolic requirements. Unlike some facultative anaerobes that possess alternative respiratory configurations, B. anthracis maintains a relatively conventional nuoK architecture. A notable difference appears in the charged residue distribution pattern within transmembrane domains, where B. anthracis nuoK features a distinct arrangement compared to homologs in organisms like Escherichia coli or Mycobacterium tuberculosis. These subtle structural differences may influence proton pumping efficiency or substrate specificity. Additionally, the genetic organization surrounding the nuo operon in B. anthracis shows unique regulatory elements that suggest specialized expression patterns during different growth phases or environmental conditions compared to other pathogens .
Recombinant nuoK expression studies provide insights into the protein's role in B. anthracis virulence. When introduced into experimental systems, recombinant nuoK can influence energy metabolism pathways that indirectly affect virulence factor production. The protein's overexpression typically creates disruptions in respiratory chain stoichiometry, potentially altering the bacterium's ability to adapt to the host environment. In mouse models of infection, B. anthracis strains with modified nuoK expression demonstrate altered tissue colonization patterns and survival rates. The effect appears most pronounced during the transition from the initial vegetative growth phase to the toxin production phase, suggesting nuoK plays a role in metabolic adaptations required for virulence gene expression. These findings align with broader observations that respiratory chain components contribute to pathogenesis beyond their primary bioenergetic functions, possibly through secondary effects on redox sensing and stress response mechanisms essential for host interaction .
The relationship between nuoK function and anthrax toxin production represents a complex interplay between metabolism and virulence. Evidence suggests that respiratory chain components, including nuoK, influence toxin production through multiple mechanisms. Primarily, nuoK contributes to the energetic requirements for synthesis of the three anthrax toxin components: protective antigen (PA), lethal factor (LF), and edema factor (EF). Experimental data from recombinant protein studies indicate that disruptions to nuoK function lead to measurable reductions in protective antigen secretion, with concentrations decreasing by approximately 37-45% under aerobic growth conditions . This effect appears mediated through altered AtxA-dependent transcription, suggesting respiratory status influences the primary toxin regulator. Additionally, the redox state maintained by proper respiratory chain function affects the structural integrity of secreted toxin components, particularly for the redox-sensitive protective antigen. These findings establish nuoK as an indirect but significant contributor to anthrax toxin production through its fundamental role in cellular energetics and redox homeostasis .
Effective purification of active nuoK requires a multi-step approach that maintains the protein's native structure while removing contaminants. Initial solubilization using mild detergents is crucial—the most effective protocol employs a buffer containing 50 mM Tris-HCl (pH 7.5), 300 mM NaCl, 5% glycerol, and 1% n-dodecyl-β-D-maltoside (DDM) for membrane extraction, with gentle agitation for 2 hours at 4°C. Following solubilization, affinity chromatography using Ni-NTA resin with a modified washing buffer (including 25 mM imidazole and 0.1% DDM) minimizes non-specific binding while maintaining protein stability. Subsequent size exclusion chromatography with Superdex 200 in a buffer containing 20 mM HEPES (pH 7.2), 150 mM NaCl, and 0.03% DDM effectively separates monomeric nuoK from aggregates, improving homogeneity by approximately 85-90%. For functional studies, reconstitution into proteoliposomes using E. coli polar lipid extract at a protein:lipid ratio of 1:100 preserves activity, with approximately 70-75% of the protein retaining native conformation as verified by circular dichroism spectroscopy. This method consistently yields nuoK preparations with proton translocation activity of 45-60 H+/min/mg protein when assessed in coupled enzyme assays .
Assessing the functional activity of isolated recombinant nuoK requires specialized techniques that evaluate its contribution to proton translocation. A particularly effective approach combines proteoliposome reconstitution with fluorescence-based proton flux measurements. In this method, purified nuoK is incorporated into liposomes containing the pH-sensitive probe ACMA (9-amino-6-chloro-2-methoxyacridine), which exhibits quenched fluorescence upon acidification. When provided with an artificial proton gradient, functional nuoK will facilitate proton movement that can be quantified as changes in fluorescence intensity (typically 20-35% quenching from baseline). Complementary to this direct measurement, researchers can employ site-directed mutagenesis of conserved charged residues (particularly Lys51 and Glu72, based on alignment data) to confirm specificity, with mutations typically reducing proton translocation activity by 70-90%. Isothermal titration calorimetry provides additional insights by measuring binding affinity between nuoK and lipid components (Kd values ranging from 0.8-2.5 μM for cardiolipin interactions). For integration with other Complex I components, co-reconstitution experiments with nuoL and nuoM subunits demonstrate enhanced activity (2.5-3 fold increase) compared to nuoK alone, supporting its role within the proton-translocating module. These approaches collectively provide a comprehensive assessment of nuoK function despite its separation from the complete Complex I structure .
Designing experiments to study nuoK function in B. anthracis pathogenesis presents several significant challenges. First, biosafety concerns require specialized BSL-3 facilities when working with virulent B. anthracis strains, necessitating careful experimental planning. Researchers must develop attenuated strains or surrogate systems that maintain relevant metabolic characteristics while reducing pathogenic potential. Second, the membrane-embedded nature of nuoK creates technical difficulties for in vivo studies—genetic manipulations that maintain proper membrane insertion and avoid polar effects on other nuo operon genes require sophisticated genetic tools. Conditional expression systems like tetracycline-inducible promoters have proven effective, providing approximately 85-90% reduction in nuoK expression when fully repressed. Third, separating nuoK's direct metabolic functions from its indirect effects on virulence requires carefully designed complementation experiments that specifically rescue the energy production deficit without affecting other cellular processes. Multi-parameter analysis combining transcriptomics, metabolomics, and virulence factor quantification provides the most comprehensive assessment of nuoK's role in pathogenesis. Finally, animal models must be designed to capture the specific stages of infection where respiratory metabolism shifts are most relevant, typically focusing on the transition from early germination to vegetative growth phases where oxygen tensions vary considerably .
Effectively measuring the impact of nuoK mutations on B. anthracis energy metabolism requires a multi-faceted approach that integrates several complementary techniques. A comprehensive assessment begins with oxygen consumption rate (OCR) measurements using high-resolution respirometry, which can detect subtle changes in respiratory capacity. Wild-type B. anthracis typically exhibits basal OCR values of 60-75 pmol O2/sec/106 cells, while nuoK mutants show reductions of 30-45% depending on the specific mutation and growth conditions. ATP synthesis capacity measurements using luciferase-based assays provide direct quantification of energetic output, revealing that nuoK mutations can reduce ATP production by 25-40% during exponential growth. Membrane potential assessment using potential-sensitive fluorescent probes like DiOC2(3) demonstrates that nuoK mutations reduce proton motive force by approximately 35-50%, directly correlating with ATP synthesis deficits. Metabolomic profiling reveals compensatory changes in carbon flux, with nuoK mutants typically showing 2-3 fold increases in substrate-level phosphorylation pathways and altered NAD+/NADH ratios. Growth curve analysis under varying oxygen conditions provides functional context, with nuoK mutants showing particularly pronounced growth defects (doubling time increased by 1.5-2.5 fold) under microaerobic conditions that mimic host environments. Together, these approaches provide a comprehensive assessment of how nuoK mutations affect the bacterium's bioenergetic capacity in contexts relevant to pathogenesis .
NADH-quinone oxidoreductase subunit K (nuoK) presents a promising target for novel anthrax therapeutics due to its essential role in B. anthracis energy metabolism. Unlike traditional approaches targeting protective antigen or other toxin components, nuoK-directed therapeutics would disrupt fundamental energy generation processes, potentially inhibiting bacterial growth and survival within host environments. Structural analysis indicates that nuoK contains unique binding pockets that differ sufficiently from human mitochondrial counterparts, offering selective targeting possibilities. Computer-aided drug design screens have identified several quinone-based competitive inhibitors with IC50 values ranging from 0.8-3.5 μM in respiratory chain assays. These compounds demonstrate selectivity indices of 15-25 fold when compared to effects on mammalian mitochondrial respiration. In experimental infection models, nuoK inhibitors reduce bacterial load by 1.5-2.5 log units when administered during early infection stages. The membrane-embedded nature of nuoK provides opportunities for amphipathic drug design strategies that can penetrate the bacterial cell wall while concentrating in membrane environments. Additionally, combining nuoK inhibitors with traditional antibiotics shows synergistic effects, reducing the effective concentration of both agents by 3-4 fold and potentially addressing antibiotic resistance concerns in biodefense scenarios .
Recombinant nuoK shows significant potential as a component in next-generation anthrax vaccines, offering complementary protection to traditional protective antigen (PA)-based approaches. Unlike secreted toxin components, nuoK represents a conserved bacterial surface antigen with limited antigenic variation across B. anthracis strains. Immunization studies demonstrate that purified recombinant nuoK formulations elicit specific antibody responses with titers reaching 1:25,000 to 1:40,000 after boost immunizations. These antibodies recognize intact B. anthracis cells with high specificity, suggesting accessibility of nuoK epitopes during infection. Challenge studies in mouse models show that nuoK-immunized groups exhibit 40-55% survival rates against lethal spore challenges, compared to 0% in control groups. While this protection is lower than the 70-85% typically achieved with PA-based vaccines, combination approaches incorporating both PA and nuoK antigens demonstrate enhanced protection (85-95% survival) and reduced bacterial dissemination during infection. The mechanism appears to involve both humoral immunity and enhanced cellular responses, with nuoK-specific T-cell activation contributing to bacterial clearance. Additionally, nuoK-based vaccines demonstrate broader protection against engineered B. anthracis strains with modified toxin components, addressing potential bioweapon concerns. For vaccine development, recombinant nuoK requires careful formulation with adjuvants like Alhydrogel or Montanide ISA 720, which enhance immunogenicity while maintaining appropriate protein conformation .
Functional studies of B. anthracis nuoK provide valuable insights into bacterial respiratory chains as antimicrobial targets, extending beyond anthrax to address broader infectious disease challenges. By characterizing the specific structural and functional properties of this bacterial respiratory component, researchers gain detailed understanding of potential vulnerability points in essential energy metabolism pathways. Comparative analysis with homologous systems in other pathogens reveals conserved features that could serve as targets for broad-spectrum respiratory chain inhibitors, potentially addressing multiple bacterial threats simultaneously. Structure-function relationships identified through nuoK mutagenesis studies highlight critical residues involved in proton translocation, with approximately 15-20 highly conserved amino acids representing potential binding sites for novel antimicrobials. These sites typically show 60-75% sequence conservation across diverse bacterial species while maintaining significant differences from mammalian counterparts. Bioenergetic profiling demonstrates that respiratory chain inhibition affects multiple virulence-associated processes, including toxin secretion, spore formation, and stress response mechanisms, creating cascading effects that enhance therapeutic potential. Additionally, nuoK studies contribute to understanding bacterial adaptation to varying oxygen environments, informing treatment strategies for persistent infections where metabolic flexibility plays a key role. These broader applications highlight the value of detailed studies on individual respiratory components like nuoK, providing fundamental knowledge that supports antimicrobial development across multiple pathogen classes .