Recombinant Bacillus anthracis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Role in Lipoprotein Biosynthesis

Lgt initiates the lipidation of prolipoproteins by transferring a diacylglyceryl moiety, a step essential for membrane localization and functionality of lipoproteins in bacteria . In B. anthracis, this process is vital for:

  • Spore Germination: lgt mutants exhibit impaired spore germination in vitro and in murine skin, leading to reduced virulence in spore-based infections .

  • Surface Hydrophobicity: Lipoprotein-deficient mutants show decreased surface hydrophobicity, affecting interactions with host tissues .

  • Immune Evasion: Heat-killed lgt mutants elicit reduced TLR2-dependent TNF-α responses in macrophages, suggesting lipoproteins modulate host immune recognition .

Impact on Virulence

Model SystemWild-Type Strainlgt MutantComplemented StrainOutcome
Spore InfectionHigh MortalityAttenuatedRestored VirulenceReduced germination and lethality in murine subcutaneous models .
Vegetative CellsFull VirulenceFull VirulenceN/ANo attenuation observed; lipoproteins are dispensable for vegetative growth .

Diagnostic and Vaccine Development

Recombinant Lgt could serve as a tool for:

  • Immune Response Studies: Evaluating TLR2-mediated recognition.

  • Biosensor Development: Detecting B. anthracis lipoproteins in clinical samples.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it when placing your order. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please specify it. We will prioritize developing the designated tag.
Synonyms
lgt; BAMEG_5444; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bacillus anthracis (strain CDC 684 / NRRL 3495)
Target Names
lgt
Target Protein Sequence
MLLGSVPQLDRVAVQLGPFPVYWYGIIIGTGVLLGLWLATREGERLGIPKDTFVDLVLIA VPIAILFARMYYVIFEWEYYAQNPSQIINIRQGGLAIHGGLIGAVVTGILFAKRRGVSFW KLADIAAPSILLGQAIGRWGNFMNQEAHGDEVTRQFLEGLHLPDFIINQMYIDGVYYHPT FLYESLWNFAGVILLLALRKVNLRRGELFFTYLIWYSIGRFFVEGLRTDSLMLGPLRIAQ VMSIGLVVISIIFIIVRRKMGQADKRYSEN
Uniprot No.

Target Background

Function
Recombinant Bacillus anthracis Prolipoprotein diacylglyceryl transferase (lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Lgt in Bacillus anthracis?

Lgt (prolipoprotein diacylglyceryl transferase) catalyzes the first and committed step in bacterial lipoprotein biosynthesis. Specifically, it transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of the invariant cysteine residue within the lipobox motif of prolipoproteins . This lipid modification anchors lipoproteins to the membrane and is crucial for their proper localization and function. In B. anthracis, Lgt processes numerous lipoproteins, including those involved in nutrient acquisition, germination, and cell envelope integrity. The gene encoding Lgt in B. anthracis Ames strain is designated as BA5391 .

How does Lgt-mediated lipoprotein processing differ between B. anthracis and Gram-negative bacteria?

While the basic function of Lgt is conserved across bacterial species, there are significant differences in the essentiality and consequences of Lgt deletion between B. anthracis and Gram-negative bacteria:

CharacteristicB. anthracis (Gram-positive)Gram-negative bacteria
EssentialityNon-essential for growthEssential for viability
Growth impactNormal growth in rich and poor mediaLethal when deleted
Cell morphologyMinimal changesN/A (lethal deletion)
VirulenceAttenuated (primarily in spore stage)N/A (lethal deletion)
Protein secretionMinimal effect on anthrax toxin secretionMajor defects in protein secretion

Unlike Gram-negative bacteria where Lgt is essential for survival, B. anthracis can grow without functional Lgt in both nutrient-rich and nutrient-poor conditions . This difference may be attributed to the single membrane structure of Gram-positive bacteria versus the double membrane of Gram-negative bacteria, where lipoproteins play more critical structural roles.

What are the most effective methods for constructing and validating an lgt-deficient B. anthracis strain?

Construction of an lgt-deficient B. anthracis strain can be effectively accomplished using the Cre-loxP recombination system, which allows for markerless gene deletion. The methodology includes:

  • Design and construction of deletion vector:

    • Amplify upstream and downstream fragments of the lgt gene (BA5391)

    • Clone these fragments into a temperature-sensitive plasmid (e.g., pSC) between loxP sites

    • Transform into B. anthracis and select at restrictive temperature

  • Cre-mediated recombination:

    • Transform with a Cre recombinase-expressing plasmid (e.g., pCrePAS)

    • Induce recombination to remove the target gene

    • Confirm deletion by PCR and sequencing

  • Complementation strategies:

    • Plasmid-based complementation: Clone the lgt gene into an expression plasmid (e.g., pSW4 with the pagA promoter)

    • In situ complementation: Reintroduce the gene into its original chromosomal location using a single crossover followed by Cre-mediated removal of plasmid sequences

  • Validation methods:

    • Metabolic labeling: Incorporate [14C]-palmitic acid to demonstrate absence of labeled lipoproteins in the mutant

    • Surface hydrophobicity assays: Measure changes in cell surface properties

    • Functional assays: Assess spore germination efficiency, virulence in animal models, and immune response induction

How can researchers effectively assess the impact of Lgt deficiency on lipoprotein processing?

To comprehensively evaluate the impact of Lgt deficiency on lipoprotein processing in B. anthracis, researchers should employ multiple complementary approaches:

  • Metabolic labeling:

    • Culture bacteria in medium containing [14C]-palmitic acid

    • Extract and separate proteins by SDS-PAGE

    • Perform autoradiography to visualize lipid-modified proteins

    • Wild-type strains will show multiple labeled bands, while lgt mutants will show no labeling

  • Proteomic analysis:

    • Compare protein profiles of cell membrane fractions, cell wall, and culture supernatants

    • Use mass spectrometry to identify and quantify lipoproteins in different cellular compartments

    • Focus on proteins with predicted lipoboxes (LVI)(ASTVI)(GAS)C motif

    • In lgt mutants, lipoproteins typically relocalize from the membrane to the culture supernatant

  • Subcellular fractionation:

    • Separate membrane, cell wall, and cytoplasmic fractions

    • Use Western blotting with antibodies against known lipoproteins

    • Assess changes in localization patterns between wild-type and mutant strains

  • Phenotypic assays:

    • Measure surface hydrophobicity using hydrocarbon partitioning

    • Assess growth in various nutrient conditions

    • Evaluate resistance to environmental stresses

How does Lgt deficiency affect B. anthracis spore germination and pathogenesis?

Lgt deficiency has profound effects on B. anthracis spore germination and pathogenesis, which can be summarized as follows:

Does Lgt deficiency affect anthrax toxin production and secretion?

Despite the significant impact on virulence, Lgt deficiency has minimal effects on anthrax toxin production and secretion:

  • Toxin secretion analysis:

    • Western blot analysis of culture supernatants shows that protective antigen (PA), lethal factor (LF), and edema factor (EF) are secreted at similar levels from wild-type and lgt mutant strains

    • This was observed in both standard BHI medium and in toxin-inducing conditions (NBY medium supplemented with 0.9% Na₂HCO₃ in 9% CO₂)

  • Quantitative comparison:

    • Densitometric analysis of band intensities reveals no significant differences in toxin protein levels between wild-type and lgt mutant supernatants

    • This indicates that the lipidation state of lipoproteins does not substantially affect the toxin secretion machinery

  • Mechanistic explanation:

    • Unlike in B. subtilis, where lgt mutation impairs protein secretion due to decreased PrsA lipoprotein chaperone activity, B. anthracis appears to maintain efficient toxin secretion despite Lgt deficiency

    • This suggests either redundancy in the secretion machinery or that properly lipidated PrsA is not critical for anthrax toxin secretion

  • Implications for virulence:

    • The attenuated virulence of the lgt mutant is therefore not due to reduced toxin production

    • Rather, it is primarily associated with the germination defect and possibly altered host-pathogen interactions

How can the Lgt protein be exploited as a potential drug target for novel antimicrobial development?

Lgt represents a promising target for antimicrobial development based on several key characteristics:

  • Essentiality profile:

    • Essential for viability in proteobacteria (Gram-negative bacteria)

    • While not essential for growth in B. anthracis, it is required for full virulence

    • This dual profile allows targeting of both Gram-positive and Gram-negative pathogens

  • Structural advantages as a target:

    • Membrane localization with accessible regions

    • Highly conserved catalytic residues across bacterial species

    • X-ray crystal structure available for structure-based drug design

    • Most variability in the arm and head domains, with higher conservation in catalytic regions

  • Target validation approaches:

    • Generate conditional depletion strains in essential organisms

    • Conduct high-throughput screening against recombinant Lgt protein

    • Validate hits using biochemical assays monitoring transfer of diacylglyceryl to substrate peptides

    • Perform whole-cell activity assays correlating with target inhibition

  • Potential resistance mechanisms:

    • Analyze natural variations in Lgt sequences across bacterial species

    • Identify non-conserved residues that might confer resistance

    • Generate and characterize resistant mutants in laboratory settings

  • Specificity considerations:

    • Target bacterial-specific features absent in eukaryotic cells

    • Focus on conserved residues in the signature transferase motif (R143 and G154)

    • Consider essential amino acids such as H103 and Y235 implicated as critical for activity

What are the structural features of Lgt that determine substrate specificity and enzyme activity?

Understanding the structural determinants of Lgt activity and specificity is crucial for both basic research and drug development:

  • Membrane topology:

    • Initial conflicting findings on membrane topology were resolved using alkaline phosphatase and beta-lactamase fusions combined with substituted cysteine accessibility method (SCAM)

    • Most models support a seven transmembrane domain structure

  • Conserved functional residues:

    • Five residues are highly conserved across all available Lgt sequences from Firmicutes, Proteobacteria, and Actinobacteria

    • Two critical residues (R143 and G154) are located in the prolipoprotein diacylglyceryl transferase signature motif

    • H103 and Y235 have been implicated as critical for Lgt activity

    • Mutation of these conserved residues to alanine prevents complementation of conditional Lgt-deficient strains

  • Structural domains:

    • The arm and head domains show the highest variability and less conserved residues

    • The catalytic core contains the most highly conserved elements

    • AlphaFold structural models are generally similar to the X-ray structure of Lgt from E. coli

  • Species specificity:

    • Complementation studies show that Lgt from proteobacteria, but not from firmicutes, can restore growth and viability of an Lgt depletion strain in E. coli

    • This suggests structural or functional differences that affect cross-species activity

  • Substrate recognition:

    • Lgt recognizes the lipobox motif (LVI)(ASTVI)(GAS)C in prolipoproteins

    • The invariant cysteine is the site of lipid attachment

    • The enzyme must also recognize phosphatidylglycerol as the lipid donor

    • The interaction between substrate peptide, phospholipid, and enzyme active site determines specificity

How do the structural and functional characteristics of Lgt differ across bacterial species?

Lgt exhibits both conserved and variable features across different bacterial phyla:

  • Phylogenetic distribution:

    • Present in all bacteria but absent from archaea

    • Shows varying degrees of sequence conservation across bacterial phyla

    • Forms distinct clades corresponding to major bacterial divisions

  • Functional conservation and divergence:

CharacteristicProteobacteriaFirmicutes (including B. anthracis)Actinobacteria
EssentialityEssentialNon-essentialEssential in some species (e.g., M. tuberculosis)
Cross-complementationCan complement E. coliCannot complement E. coliVariable
Structural features7 transmembrane domains7 transmembrane domains7 transmembrane domains
Conserved motifsProlipoprotein diacylglyceryl transferase signatureSame signature, but functional differencesSame signature
  • Variations in lipoprotein processing:

    • In Mycobacterium species, lipoproteins are modified with tuberculostearic and palmitic acids

    • The membrane anchor of mycobacterial lipoproteins contains a thioether-linked diacylglyceryl residue

    • These modifications differ from those in other bacteria and may affect Lgt substrate interactions

  • Evolutionary implications:

    • The essentiality pattern suggests different evolutionary pressures

    • Differences in cell envelope architecture likely contribute to varying dependency on Lgt

    • The inability of firmicute Lgt to complement proteobacterial Lgt suggests functional divergence despite structural similarity

How does the germination-specific role of Lgt in B. anthracis compare to its role in other spore-forming bacteria?

The role of Lgt in spore germination appears to be conserved across spore-forming bacteria, but with species-specific variations:

  • Comparative germination phenotypes:

    • B. anthracis lgt mutants show significantly impaired germination

    • Similar germination defects are observed in B. subtilis lgt mutants

    • The first identification of lgt in B. subtilis actually came from a search for germination mutants, and the gene was initially designated gerF

  • Germination receptor differences:

    • B. anthracis contains five germination operons (GerH, GerK, GerL, GerS, and GerX)

    • Each operon contains a C gene encoding a lipoprotein component

    • Additionally, gerD and gerM genes also encode lipoproteins involved in germination

    • The specific arrangement and combination of germination receptors varies across species

  • Molecular mechanisms:

    • In B. subtilis, GerD colocalizes with germinant receptor proteins and accelerates their signaling

    • Mutation of the cysteine in the lipobox of GerD leads to spores lacking the protein and having a severe germination defect

    • This phenotype is similar to that observed with complete gerD deletion or lgt deletion

    • The localization and interaction of germination proteins are dependent on proper lipidation

  • In vivo relevance:

    • The germination defect in B. anthracis lgt mutants translates to attenuated virulence in mouse models

    • This connection between germination and virulence may vary in other pathogenic spore-formers depending on their infection strategy

    • Environmental spore-formers may have evolved different dependencies on lipoproteins for germination based on their ecological niches

What are the optimal experimental models for studying B. anthracis Lgt in the context of vaccine and therapeutic development?

Several experimental models are suitable for studying B. anthracis Lgt in vaccine and therapeutic development contexts:

  • Mouse models:

    • B10.D2-Hc⁰ mice: Complement-deficient mice are highly susceptible to B. anthracis infection, requiring lower doses for meaningful challenge studies

    • A/J mice: Complement-deficient and highly susceptible to non-encapsulated toxigenic B. anthracis

    • C57BL/6J mice: Complement-sufficient mice require higher doses but may better model immunocompetent human responses

  • Bacterial strains:

    • Attenuated strains: B. anthracis Pasteur II (pXO1+, pXO2-) provides a safer alternative for initial screening

    • Virulent strains: Fully virulent strains (with appropriate biosafety measures) are essential for final validation

    • Reporter strains: Engineered strains expressing fluorescent or luminescent proteins can facilitate tracking of infection progression

  • In vitro systems:

    • Macrophage infection models: Allow assessment of bacterial survival and host response

    • Germination assays: Optical density measurements and heat resistance tests provide quantitative data on germination efficiency

    • Toxin neutralization assays: Measure the ability of vaccines to neutralize anthrax toxins

  • Administration routes for challenge studies:

    • Subcutaneous injection: Models cutaneous infection

    • Intratracheal aerosolization: Better models inhalational anthrax, the most severe form

    • Intravenous injection: Allows direct delivery to organ sites

  • Assessment parameters:

    • Survival rates and LD₅₀ determination

    • Bacterial burden in tissues (CFU/g or CFU/mL)

    • Distinction between vegetative bacteria and ungerminated spores using heat treatment

    • Immune response measurements (antibody titers, cytokine profiles)

How can genome-wide approaches be applied to better understand the Lgt-dependent lipoproteome of B. anthracis?

Modern genome-wide approaches can significantly advance our understanding of the B. anthracis lipoproteome:

  • Bioinformatic prediction:

    • Scan the B. anthracis genome for predicted lipoproteins based on signal peptides and lipobox motifs

    • Utilize improved prediction algorithms that account for bacterial species-specific variations in lipobox preferences

    • Classify predicted lipoproteins by function and subcellular localization

  • Comparative proteomics:

    • Compare protein profiles of wild-type and lgt mutant strains across multiple cellular fractions:

      • Membrane fraction

      • Cell wall fraction

      • Culture supernatant

    • Quantify differences using SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) labeling

    • Follow the approach demonstrated for M. smegmatis, where 106 proteins were identified and quantified in the secretome, including 20 lipoproteins that were secreted at higher levels in the Δlgt mutant

  • Transcriptomic analysis:

    • Perform RNA-Seq comparing wild-type and lgt mutant strains

    • Identify compensatory changes in gene expression resulting from lipoprotein mislocalization

    • Map regulatory networks affected by Lgt deficiency

  • Functional screening:

    • Create a library of mutants with deletions in predicted lipoproteins

    • Screen for phenotypes related to germination, virulence, and stress resistance

    • Identify key lipoproteins that contribute to the lgt mutant phenotype

  • Structural biology:

    • Determine structures of B. anthracis Lgt and key lipoproteins

    • Use cryo-EM to visualize Lgt in its native membrane environment

    • Apply hydrogen-deuterium exchange mass spectrometry to map protein-protein interactions involving lipoproteins

What are the common challenges in expressing and purifying recombinant B. anthracis Lgt, and how can they be addressed?

Working with recombinant Lgt presents several challenges due to its membrane-embedded nature:

  • Expression system selection:

Expression SystemAdvantagesDisadvantagesRecommendations
E. coliHigh yield, established protocolsMay misfold membrane proteinsUse C41(DE3) or C43(DE3) strains designed for membrane proteins
B. subtilisNative-like membrane environmentLower yield, more complex geneticsConsider for functional studies requiring native-like environment
Cell-free systemsAvoids toxicity issues, direct access to reaction environmentExpensive, may require optimizationUseful for difficult-to-express variants
  • Solubilization and purification strategies:

    • Test multiple detergents (DDM, LDAO, CHAPS) for optimal solubilization

    • Consider nanodiscs or amphipols for maintaining native-like lipid environment

    • Use affinity tags positioned to avoid interference with membrane topology

    • Implement two-step purification (e.g., IMAC followed by size exclusion chromatography)

  • Protein quality assessment:

    • Circular dichroism to confirm secondary structure

    • Dynamic light scattering to assess homogeneity

    • Functional assays measuring diacylglyceryl transferase activity

    • Thermal shift assays to evaluate stability in different conditions

  • Activity preservation:

    • Include appropriate lipids during purification and storage

    • Store in small aliquots to avoid freeze-thaw cycles

    • Optimize buffer conditions (pH, salt concentration, glycerol content)

How can researchers effectively design and validate assays to measure Lgt enzyme activity for inhibitor screening?

Developing robust assays for Lgt activity is essential for inhibitor screening:

  • Radiometric assays:

    • Use [14C]-labeled phosphatidylglycerol as substrate

    • Measure transfer to synthetic peptides containing lipobox motifs

    • Separate products by thin-layer chromatography or precipitation

    • Advantages: high sensitivity; Disadvantages: requires radioactive materials

  • Fluorescence-based assays:

    • Develop FRET-based peptide substrates that change signal upon lipidation

    • Use environmentally sensitive fluorophores that respond to membrane association

    • Advantages: amenable to high-throughput screening; Disadvantages: may require custom substrate synthesis

  • Mass spectrometry-based assays:

    • Monitor conversion of peptide substrates to lipidated products

    • Can be quantitative and provide structural information

    • Advantages: high specificity; Disadvantages: lower throughput

  • Whole-cell reporter assays:

    • Engineer reporter systems dependent on lipoprotein localization

    • Example: β-lactamase fusions that only provide resistance when properly lipidated

    • Advantages: identifies cell-permeable inhibitors; Disadvantages: potential false positives from off-target effects

  • Assay validation parameters:

    • Signal-to-background ratio ≥ 3

    • Z' factor ≥ 0.5 for high-throughput applications

    • Reproducibility across replicates (CV < 15%)

    • Correlation between different assay formats

    • Activity of positive controls (e.g., known Lgt inhibitors if available)

    • Counter-screens to eliminate false positives

How does understanding Lgt function contribute to the development of new anthrax vaccines or therapeutics?

Understanding Lgt function opens several avenues for anthrax vaccine and therapeutic development:

  • Attenuated vaccine strains:

    • lgt-deficient strains as potential live attenuated vaccines

    • The reduced virulence of spores while maintaining anthrax toxin production creates a balanced attenuation profile

    • Potential advantages: induction of broader immunity against multiple antigens

    • Potential disadvantages: safety concerns with any live vaccine approach

  • Subunit vaccine enhancement:

    • Identification of immunogenic lipoproteins processed by Lgt

    • Incorporation of these lipoproteins into recombinant protective antigen (rPA) formulations

    • Potential for broader protection beyond toxin neutralization

    • Could address limitations of current anthrax vaccines that require complex immunization procedures

  • Delivery system optimization:

    • Knowledge of lipoprotein trafficking can inform vaccine adjuvant design

    • Lipidation of antigens can enhance immunogenicity

    • Targeting of germination-specific lipoproteins may improve vaccine efficacy against spores

  • Therapeutic targets:

    • Lgt inhibitors as potential therapeutics for established infection

    • Targeting germination through Lgt-dependent processes could prevent disease progression

    • Combination approaches targeting both toxin production and lipoprotein processing

  • Diagnostic applications:

    • Lipoproteins as biomarkers for B. anthracis identification

    • Detection of lipoprotein processing as an indicator of metabolically active bacteria

    • Distinction between vegetative cells and dormant spores

What are the potential advantages and limitations of targeting Lgt compared to other anthrax therapeutic approaches?

Targeting Lgt presents unique advantages and limitations compared to other anthrax therapeutic approaches:

ApproachAdvantagesLimitationsCurrent Status
Lgt inhibition- Novel mechanism of action
- Potential broad-spectrum activity
- May affect both germination and virulence
- Not essential for B. anthracis growth
- May require combination therapy
- No validated inhibitors yet identified
Early research stage
Antibiotics- Well-established efficacy
- Multiple approved options
- Known pharmacokinetics
- Resistance development
- Limited efficacy after symptoms develop
- May not affect toxin already produced
Standard of care
Antitoxin antibodies- Specifically neutralize toxins
- Complementary to antibiotics
- Approved products (raxibacumab, obiltoxaximab)
- Do not eliminate the bacteria
- Limited window of efficacy
- High cost
FDA-approved
Capsule depolymerase- Novel mechanism targeting capsule
- Effective against multi-drug resistant strains
- Can provide protection without antibiotics
- Limited to encapsulated bacteria
- May require combination therapy
- Early development stage
Experimental (pegylated CapD)
Germination inhibitors- Prevent disease initiation
- May have broader applications
- Low resistance potential
- Limited efficacy once germination occurs
- Narrow window of opportunity
- Need for rapid administration
Experimental

Potential advantages of Lgt inhibitors include:

  • Novel mechanism that differs from conventional antibiotics

  • May affect multiple virulence determinants simultaneously by impairing lipoprotein function

  • Could potentially be effective against both vegetative cells and spores

  • Lower selection pressure for resistance due to non-essentiality in B. anthracis

Limitations include:

  • Since Lgt is not essential for growth in B. anthracis, inhibitors alone may not be bactericidal

  • Vegetative cells remain virulent even without Lgt, suggesting limitations for treating established infections

  • Development of specific inhibitors may be challenging due to the membrane-embedded nature of the target

  • Limited clinical experience with bacterial lipoprotein biosynthesis inhibitors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.