Recombinant Bacillus anthracis UPF0059 membrane protein BAMEG_5613 (BAMEG_5613)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bacillus anthracis UPF0059 Membrane Protein BAMEG_5613 (BAMEG_5613)

Recombinant Bacillus anthracis UPF0059 membrane protein BAMEG_5613 (BAMEG_5613) is a full-length, engineered protein derived from the Bacillus anthracis genome. This protein belongs to the UPF0059 family of uncharacterized membrane proteins, which are conserved across bacterial species and hypothesized to play roles in cell envelope integrity or transport processes . The recombinant form is expressed in Escherichia coli with an N-terminal polyhistidine (His) tag for purification and detection purposes .

Expression and Purification

The recombinant BAMEG_5613 is produced in E. coli as a soluble protein, leveraging the His tag for affinity chromatography . This system ensures high yield and purity (>95%), critical for structural studies or antibody development.

Potential Research Applications

  • Vaccine Development: Recombinant membrane proteins like PA63 (protective antigen) are key targets for anthrax vaccines . BAMEG_5613 could serve as a candidate for epitope mapping or adjuvant studies.

  • Pathogenesis Studies: Investigating its role in membrane integrity or interaction with host cells could elucidate anthrax virulence mechanisms .

  • Diagnostic Tools: His-tagged BAMEG_5613 may aid in developing ELISA assays to detect anthrax-specific antibodies .

Comparative Analysis with Other Bacillus anthracis Proteins

ProteinFunctionRecombinant Use Case
BAMEG_5613Membrane integrity (hypothesized)Structural studies, vaccine design
Protective AntigenToxin component, cell entryVaccine development
Sap/EA1S-layer assembly, SCWP bindingHost-pathogen interaction studies
KrrARNA-binding, stress response regulationGene expression studies

Challenges and Future Directions

Current limitations include the lack of direct functional data for BAMEG_5613. Future work should prioritize:

  1. Structural Characterization: X-ray crystallography or cryo-EM to resolve its 3D architecture.

  2. Knockout Studies: Assessing phenotypic changes in B. anthracis lacking BAMEG_5613.

  3. Interaction Mapping: Identifying binding partners via pull-down assays or yeast two-hybrid screens.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; BAMEG_5613; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus anthracis (strain CDC 684 / NRRL 3495)
Target Names
mntP
Target Protein Sequence
MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALKIRQILYIGVTIGIFHIIMPFIGMVLGR FLSEQYGDIAHFAGAILLIGLGFYIVYSSILENEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTIITILLFGFVSMLLAWIGLLIGRHAKGMLGTYGEIVGGIILVGFGLYLLF PI
Uniprot No.

Target Background

Function
This protein is likely involved in manganese efflux, acting as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the secondary and tertiary structure of BAMEG_5613 compare to other bacterial membrane proteins?

While specific crystallographic data for BAMEG_5613 is limited, computational predictions suggest that this protein follows the typical structural pattern of bacterial membrane transport proteins with multiple transmembrane domains. The protein likely contains several alpha-helical segments that span the membrane, creating a channel-like structure.

The protein's sequence contains alternating hydrophobic and hydrophilic regions, consistent with transmembrane segments and connecting loops. Unlike many other bacterial membrane transporters, BAMEG_5613 appears to lack large extracellular domains, suggesting a more compact structural organization focused primarily on its transport function.

Comparative structural analysis with other bacterial manganese transporters indicates conserved motifs in the transmembrane regions that likely form the metal binding and transport pathway. Further structural studies using techniques such as X-ray crystallography or cryo-electron microscopy would be necessary to fully elucidate its three-dimensional configuration .

What expression systems are most effective for producing recombinant BAMEG_5613?

Based on available research data, the most effective expression system for BAMEG_5613 is Escherichia coli. Specifically, recombinant BAMEG_5613 has been successfully expressed as a soluble protein in E. coli with an N-terminal His tag. This approach allows for efficient expression while maintaining protein functionality .

For optimal expression, consider these methodological guidelines:

  • Use E. coli strains optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

  • Employ a low-temperature induction protocol (16-18°C) to minimize inclusion body formation

  • Include osmolytes or mild detergents in the culture medium to stabilize the membrane protein

  • Consider codon optimization of the BAMEG_5613 sequence for E. coli expression

  • Use tightly regulated promoters (like T7) with careful induction parameters

While alternative expression systems such as yeast or insect cells might theoretically provide advantages for membrane protein expression, current literature supports E. coli as the most well-established system for this specific protein .

What purification protocols yield the highest purity and activity for recombinant BAMEG_5613?

To achieve high purity (>90%) and maintain activity of recombinant BAMEG_5613, a multi-step purification protocol is recommended:

Step 1: Initial Extraction

  • Carefully lyse cells using mild detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) to solubilize membrane proteins

  • Maintain buffer pH at 8.0 throughout the process to ensure protein stability

Step 2: Affinity Chromatography

  • Utilize Nickel-NTA affinity chromatography for His-tagged protein

  • Apply a gradual imidazole gradient (10-250 mM) to minimize co-purification of contaminants

  • Include low concentrations of detergent in all buffers

Step 3: Size Exclusion Chromatography

  • Further purify using gel filtration to separate monomeric protein from aggregates

  • Use buffer containing 150 mM NaCl, 20 mM Tris-HCl (pH 8.0), and 0.03% appropriate detergent

Step 4: Quality Assessment

  • Confirm purity via SDS-PAGE (should exceed 90%)

  • Verify identity through Western blotting or mass spectrometry

The final purified protein should be stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0. For long-term storage, addition of 50% glycerol and aliquoting followed by storage at -20°C/-80°C is recommended to avoid repeated freeze-thaw cycles .

What is the putative function of BAMEG_5613 in Bacillus anthracis and how can it be experimentally verified?

BAMEG_5613 (also known as mntP) is annotated as a putative manganese efflux pump in Bacillus anthracis. This membrane protein likely plays a crucial role in manganese homeostasis, which is essential for bacterial survival and virulence. Excess manganese can be toxic to bacterial cells, and efflux systems help maintain appropriate intracellular concentrations of this metal.

Experimental Verification Methods:

  • Metal Transport Assays:

    • Measure Mn²⁺ uptake/efflux using radioactive ⁵⁴Mn²⁺ in cells expressing BAMEG_5613 versus control cells

    • Monitor intracellular manganese concentrations using fluorescent probes or ICP-MS

  • Growth Phenotype Analysis:

    • Compare growth of wild-type, BAMEG_5613 deletion mutants, and complemented strains under varying manganese concentrations

    • Expected result: Deletion mutants would show increased sensitivity to high manganese concentrations

  • Site-Directed Mutagenesis:

    • Identify conserved residues in the protein sequence likely involved in metal binding

    • Create point mutations and assess their impact on transport activity

  • Protein-Metal Interaction Studies:

    • Use isothermal titration calorimetry (ITC) with purified protein to determine binding affinity for manganese

    • Employ electron paramagnetic resonance (EPR) to characterize metal coordination sites

  • Electrophysiology:

    • Reconstitute purified protein in lipid bilayers and measure ion conductance

These approaches would collectively provide strong evidence for the manganese efflux function of BAMEG_5613 and characterize its transport properties and metal specificity .

How does BAMEG_5613 contribute to Bacillus anthracis virulence and pathogenicity?

The contribution of BAMEG_5613 to Bacillus anthracis virulence represents an area requiring further research, but several mechanistic hypotheses can be proposed based on our understanding of bacterial metal transporters:

Potential Virulence Mechanisms:

  • Manganese Homeostasis and Oxidative Stress Defense

    • BAMEG_5613, as a putative manganese efflux pump, likely helps B. anthracis maintain optimal intracellular manganese levels

    • Manganese serves as a cofactor for superoxide dismutase and other enzymes that protect against host-generated reactive oxygen species

    • Proper metal homeostasis is crucial for bacterial survival within macrophages

  • Metal Competition During Infection

    • Host nutritional immunity restricts metal availability to pathogens

    • BAMEG_5613 may help B. anthracis adapt to changing metal concentrations in different host environments

  • Regulatory Interplay with Virulence Factors

    • Metal-responsive transcription factors often regulate both metal transporters and virulence genes

    • BAMEG_5613 expression may be co-regulated with toxin components or other virulence factors

Experimental Approaches to Test These Hypotheses:

  • Create isogenic BAMEG_5613 deletion mutants and compare:

    • Survival within macrophages and neutrophils

    • Resistance to oxidative stress

    • Virulence in animal models

  • Perform transcriptomic and proteomic analyses to identify gene networks co-regulated with BAMEG_5613 under infection-relevant conditions

  • Measure the impact of BAMEG_5613 deletion on protective antigen (PA) and other toxin components' expression and activity

While not directly established as a vaccine target like protective antigen (PA), understanding BAMEG_5613's role in pathogenesis could potentially identify new therapeutic approaches targeting bacterial metal homeostasis .

How can BAMEG_5613 be incorporated into anthrax vaccine development strategies?

While the primary anthrax vaccine development has focused on protective antigen (PA) as the main immunogen, incorporating additional components like BAMEG_5613 represents a potentially valuable approach for next-generation vaccines. Based on research with other B. anthracis proteins, several strategies can be proposed:

Integration Strategies for Vaccine Development:

  • Combination Antigen Approach

    • Co-administer purified recombinant BAMEG_5613 with protective antigen (PA)

    • Research with other B. anthracis proteins has demonstrated that combination approaches can enhance protection compared to PA alone

    • This approach may provide broader immunity against multiple bacterial components

  • Chimeric Protein Design

    • Create fusion proteins combining immunogenic epitopes of BAMEG_5613 with PA domains

    • Previous studies have successfully developed PA domain chimeras (e.g., PA-D1-4) with enhanced immunogenicity

    • Such constructs could potentially stimulate immune responses against both toxin and membrane components

  • Adjuvant Formulation Optimization

    • Test BAMEG_5613 with human-compatible adjuvants (Addavax, Alhydrogel, Montanide ISA 720)

    • Different adjuvants may elicit distinct immune responses against membrane proteins

    • Subunit vaccines require appropriate adjuvants to enhance immunogenicity

  • Evaluation Protocol

    • Assess antibody titers using ELISA

    • Evaluate functional immunity through toxin neutralization assays

    • Perform survival analysis following challenge with B. anthracis spores

    • Compare results to standard PA-only formulations

Initial immunization studies should follow protocols similar to those used for other B. anthracis antigens, such as subcutaneous administration of 20μg protein with appropriate adjuvant, followed by booster doses on days 14 and 28 .

What experimental models are most appropriate for studying BAMEG_5613 function in vitro and in vivo?

Selecting appropriate experimental models is crucial for studying BAMEG_5613 function. Based on established approaches in B. anthracis research, the following models are recommended:

In Vitro Models:

  • Cell Culture Systems

    • RAW 264.7 macrophage cell line: Useful for studying protein interactions with host cells

    • Protocol: Seed cells in DMEM with 10% FBS; incubate with recombinant protein (5μg/ml) for binding studies

    • Detection: Use anti-BAMEG_5613 antibodies followed by fluorescent secondary antibodies; analyze by flow cytometry

  • Reconstituted Membrane Systems

    • Liposomes incorporating purified BAMEG_5613

    • Planar lipid bilayers for electrophysiological measurements

    • Nanodiscs for structural and functional studies in a membrane-like environment

  • Bacterial Genetic Systems

    • BAMEG_5613 deletion mutants in attenuated B. anthracis strains (e.g., Sterne)

    • Complementation studies with wild-type and mutant versions

    • Heterologous expression in E. coli for comparative transport studies

In Vivo Models:

  • Mouse Models

    • BALB/c mice: Standard model for immunological studies

    • A/J mice: More susceptible to B. anthracis infection, useful for challenge studies

    • Protocol: Immunize subcutaneously with 20μg antigen formulation, with boosters on days 14 and 28

  • Guinea Pig Model

    • More closely mimics human anthrax disease progression

    • Useful for advanced vaccine efficacy studies

  • Non-Human Primate Models

    • Reserved for late-stage validation

    • Provides closest physiological relevance to human infection

Ethical Considerations:
All animal studies must comply with institutional animal ethics committees and national regulations (e.g., CPCSEA guidelines). Studies involving B. anthracis require appropriate biosafety level facilities (BSL3 for virulent strains) .

How do post-translational modifications affect BAMEG_5613 structure and function?

Post-translational modifications (PTMs) of bacterial membrane proteins like BAMEG_5613 can significantly impact their structure, localization, and function. While specific PTM data for BAMEG_5613 is limited, several potential modifications warrant investigation:

Key Post-Translational Modifications:

  • Phosphorylation

    • Bacterial sensor kinases often phosphorylate membrane proteins to regulate transport activity

    • Potential phosphorylation sites in BAMEG_5613 can be predicted using tools like NetPhos or Phosphosite

    • Experimental approach: Mass spectrometry-based phosphoproteomics of B. anthracis membrane fractions

  • Lipid Modifications

    • Bacterial membrane proteins may undergo lipidation to enhance membrane association

    • Analysis of BAMEG_5613 sequence for lipidation motifs may reveal potential modification sites

  • Proteolytic Processing

    • N-terminal signal sequences are often cleaved during membrane insertion

    • Determination of the mature protein's N-terminus by Edman degradation or mass spectrometry

  • Disulfide Bond Formation

    • While relatively rare in cytoplasmic bacterial proteins, disulfide bonds in periplasmic domains can stabilize structure

    • Analyze cysteine residues in BAMEG_5613 for potential disulfide formation

Experimental Approaches:

To study the impact of PTMs on BAMEG_5613, researchers should consider:

  • Site-directed mutagenesis of potential modification sites followed by functional assays

  • Comparative mass spectrometry of the protein isolated under different growth conditions

  • In vitro modification assays using purified kinases or other modifying enzymes

  • Structural analysis of modified versus unmodified protein

Understanding these modifications may reveal regulatory mechanisms controlling manganese transport and provide insights into how BAMEG_5613 function adapts to changing environmental conditions during infection .

What structural and functional differences exist between BAMEG_5613 and homologous proteins in other bacterial species?

Comparative analysis of BAMEG_5613 with homologous proteins from other bacterial species reveals important evolutionary relationships and functional specializations:

Structural Comparison:

SpeciesProteinSequence Identity (%)Length (aa)Key Structural Differences
B. anthracisBAMEG_5613100182Reference protein
B. cereusMntP~95182Highly conserved, nearly identical structure
E. coliMntP~40178Shorter loops between transmembrane domains
S. aureusMntE~35190Extended C-terminal domain with additional metal binding sites
M. tuberculosisCtpC~25725Much larger protein with additional domains

Functional Divergence:

  • Metal Specificity

    • While BAMEG_5613 is predicted to primarily transport manganese, homologs in other species may have evolved broader or different metal specificities

    • E. coli MntP shows high selectivity for Mn²⁺ over other divalent metals

    • S. aureus MntE can transport both Mn²⁺ and Zn²⁺

    • Experimental approach: Compare metal transport profiles using radioisotopes or ICP-MS

  • Regulatory Mechanisms

    • Expression control varies between species:

      • In B. anthracis and related Bacillus species: Likely regulated by MntR

      • In E. coli: Regulated by MntR and possibly other metal-sensing regulators

      • In S. aureus: Regulated by both MntR and Fur systems

  • Contribution to Virulence

    • Different pathogens face distinct metal-related challenges during infection:

      • B. anthracis: BAMEG_5613 likely important during macrophage invasion

      • S. aureus: MntE crucial for surviving neutrophil oxidative burst

      • M. tuberculosis: CtpC essential for long-term persistence

Research Implications:

Understanding these differences can inform:

  • Design of species-specific inhibitors targeting metal transport systems

  • Prediction of functional roles based on structural conservation

  • Evolution of metal homeostasis systems in bacterial pathogens

Experimental approaches should include heterologous expression of homologs in a common host to directly compare functional properties under identical conditions .

What are the common challenges in expressing and purifying membrane proteins like BAMEG_5613, and how can they be addressed?

Membrane proteins present unique challenges during expression and purification. For BAMEG_5613, researchers should anticipate and address the following issues:

Challenge 1: Low Expression Levels

  • Problem: Membrane protein overexpression often taxes the cellular machinery and leads to toxicity

  • Solutions:

    • Use tightly controlled induction systems (e.g., pBAD or Tet-inducible)

    • Lower induction temperature to 16-18°C for overnight expression

    • Consider E. coli strains specifically designed for membrane protein expression (C41/C43)

    • Supplement growth media with compounds that alleviate membrane stress (e.g., betaine, sorbitol)

Challenge 2: Protein Misfolding and Aggregation

  • Problem: Membrane proteins tend to form inclusion bodies when overexpressed

  • Solutions:

    • Express as fusion proteins with solubility enhancers (MBP, SUMO)

    • Optimize buffer conditions during cell lysis (mild detergents, high salt)

    • Include stabilizing agents during purification (glycerol, trehalose)

    • Consider on-column refolding protocols if inclusion bodies form

Challenge 3: Detergent Selection

  • Problem: Finding detergents that efficiently extract BAMEG_5613 while maintaining its native conformation

  • Solutions:

    • Screen multiple detergents (DDM, LDAO, CHAPS, etc.)

    • Use detergent mixtures for initial extraction

    • Consider gentler alternatives like nanodisc technology or styrene maleic acid copolymer (SMA)

    • Implement a detergent exchange step during purification

Challenge 4: Maintaining Stability During Storage

  • Problem: Membrane proteins often lose activity during storage

  • Solutions:

    • Store in buffers containing 6% trehalose and 50% glycerol

    • Aliquot and flash-freeze to minimize freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    • Consider lyophilization for long-term storage

Troubleshooting Workflow for BAMEG_5613 Purification:

  • Verify expression using Western blotting before attempting purification

  • If protein is in inclusion bodies, attempt extraction with stronger detergents (8M urea followed by refolding)

  • Monitor protein stability throughout purification using dynamic light scattering

  • Confirm protein functionality using binding assays or limited proteolysis to assess folding

Following the recommended reconstitution protocol is crucial: reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL, add glycerol to a final concentration of 50%, and aliquot for long-term storage at -20°C/-80°C .

How can researchers troubleshoot experimental design issues when studying BAMEG_5613 interactions with host cells?

When investigating BAMEG_5613 interactions with host cells, researchers frequently encounter experimental challenges that require systematic troubleshooting:

Challenge 1: Low Signal-to-Noise in Binding Assays

  • Problem: Difficulty detecting specific interactions between BAMEG_5613 and host cell receptors

  • Troubleshooting Steps:

    • Optimize protein:cell ratio (test concentrations from 1-20 μg/ml)

    • Reduce non-specific binding by including blocking agents (1-2% BSA)

    • Increase sensitivity using directly labeled protein rather than antibody detection

    • Consider crosslinking approaches to stabilize transient interactions

    • Use flow cytometry for quantitative analysis of binding events

Challenge 2: Distinguishing Specific from Non-specific Uptake

  • Problem: Determining whether BAMEG_5613 internalization is receptor-mediated or non-specific

  • Troubleshooting Steps:

    • Perform competition assays with unlabeled protein

    • Compare uptake at 37°C versus 4°C (active versus passive processes)

    • Use endocytosis inhibitors to block specific uptake pathways

    • Generate non-binding mutants as negative controls

    • Use confocal microscopy to track intracellular localization

Challenge 3: Cell Cytotoxicity Issues

  • Problem: Membrane proteins in detergent solutions may cause cell toxicity

  • Troubleshooting Steps:

    • Test detergent-only controls to distinguish protein-specific effects

    • Reduce detergent concentration below CMC during cell exposure

    • Consider detergent removal using Bio-Beads or dialysis before cell experiments

    • Use MTT or LDH assays to quantify cell viability

Challenge 4: Reproducibility Between Experiments

  • Problem: Variable results between experimental replicates

  • Troubleshooting Steps:

    • Standardize protein preparation (consistent purification protocol)

    • Use the same passage number for cell lines

    • Implement rigorous positive and negative controls

    • Normalize data to account for day-to-day variations

    • Consider developing stable cell lines expressing receptors of interest

Specific Protocol Recommendations for RAW 264.7 Cell Studies:
Based on successful approaches with other B. anthracis proteins, researchers should:

  • Seed 6×10⁵ RAW 264.7 cells per well in six-well plates

  • Culture in DMEM with 10% FBS until confluent

  • Dilute recombinant BAMEG_5613 to 5μg/ml in serum-free DMEM

  • Incubate cells with protein for 1 hour at 37°C

  • Wash cells thoroughly with sterile PBS (3× minimum)

  • Detect bound protein using specific antibodies and flow cytometry or immunofluorescence

These methodologies can be modified to study various aspects of BAMEG_5613-host cell interactions, including binding kinetics, internalization pathways, and downstream cellular responses.

What genomic and proteomic approaches could advance our understanding of BAMEG_5613 regulation in different environmental conditions?

Advanced genomic and proteomic methodologies offer powerful approaches to elucidate BAMEG_5613 regulation across various environmental conditions relevant to B. anthracis pathogenesis:

Transcriptomic Approaches:

  • RNA-Seq Analysis

    • Compare BAMEG_5613 expression profiles under varying manganese concentrations

    • Analyze transcriptional changes in different infection-relevant conditions (pH shifts, oxygen tension, host cell contact)

    • Identify co-regulated genes to map the complete manganese regulon

  • Chromatin Immunoprecipitation Sequencing (ChIP-Seq)

    • Identify transcription factors that directly regulate BAMEG_5613 expression

    • Map binding sites for metal-responsive regulators like MntR

    • Characterize the promoter architecture controlling expression

  • Single-Cell RNA-Seq

    • Assess cell-to-cell variability in BAMEG_5613 expression

    • Identify distinct bacterial subpopulations with differential expression profiles

Proteomic Approaches:

  • Quantitative Proteomics

    • Use SILAC or TMT labeling to quantify BAMEG_5613 protein levels under different conditions

    • Compare protein abundance between virulent and attenuated B. anthracis strains

  • Protein-Protein Interaction Studies

    • Employ proximity labeling techniques (BioID, APEX) to identify interaction partners

    • Use co-immunoprecipitation followed by mass spectrometry to map the BAMEG_5613 interactome

    • Identify potential regulatory proteins that modulate transport activity

  • Post-Translational Modification Analysis

    • Apply phosphoproteomics to identify regulatory phosphorylation sites

    • Characterize other modifications that might affect protein function

Integrated Multi-Omics Approach:

TechniqueApplicationExpected Outcome
RNA-SeqTranscriptional profilingIdentification of conditions triggering BAMEG_5613 expression
ChIP-SeqRegulatory network mappingCharacterization of transcription factor binding sites
ProteomicsProtein abundance quantificationCorrelation between transcription and translation
MetabolomicsMetal homeostasis profilingImpact of BAMEG_5613 on cellular manganese levels
Structural BiologyProtein conformation analysisEffect of environmental conditions on protein structure

By integrating these approaches, researchers can develop a comprehensive model of how BAMEG_5613 responds to environmental cues, potentially identifying new strategies to disrupt bacterial metal homeostasis during infection .

How might BAMEG_5613 contribute to antimicrobial resistance, and what therapeutic approaches could target this protein?

The potential role of BAMEG_5613 in antimicrobial resistance and its viability as a therapeutic target represents an emerging research frontier:

Potential Contributions to Antimicrobial Resistance:

  • Metal Homeostasis and Antibiotic Tolerance

    • Proper manganese balance may enhance bacterial survival under antibiotic stress

    • Manganese serves as a cofactor for enzymes involved in oxidative stress defense, potentially protecting against antibiotics that generate reactive oxygen species

    • BAMEG_5613 dysfunction could alter membrane permeability, affecting antibiotic uptake

  • Biofilm Formation and Persistence

    • Metal transporters often influence biofilm development

    • BAMEG_5613 may contribute to establishing optimal metal concentrations within biofilms

    • Biofilms provide inherent resistance to antibiotics and host immune responses

  • Regulatory Cross-talk

    • Metal-responsive regulators may cross-regulate antibiotic resistance genes

    • Disruption of metal homeostasis could trigger stress responses that activate resistance mechanisms

Therapeutic Approaches Targeting BAMEG_5613:

  • Direct Inhibition Strategies

    • Develop small molecule inhibitors that block the transport channel

    • Design peptide inhibitors targeting accessible extracellular loops

    • Predicted therapeutic outcome: Disruption of manganese homeostasis, increasing susceptibility to oxidative stress

  • Immunotherapeutic Approaches

    • Generate antibodies against BAMEG_5613 extracellular epitopes

    • Develop antibody-antibiotic conjugates for targeted delivery

    • Predicted outcome: Enhanced opsonization and potential transport inhibition

  • Metal Ionophore Combination Therapy

    • Combine BAMEG_5613 inhibitors with manganese ionophores to disrupt metal balance

    • Exploit synthetic lethality between transport inhibition and altered intracellular metal levels

    • Predicted outcome: Bacterial cell death through dysregulated metal homeostasis

  • Anti-virulence Approach

    • Target BAMEG_5613 to reduce virulence without directly killing bacteria

    • May reduce selective pressure for resistance development

    • Predicted outcome: Attenuated pathogenicity while maintaining bacterial viability

Experimental Validation Framework:

To assess BAMEG_5613 as a therapeutic target, researchers should:

  • Determine the impact of BAMEG_5613 deletion on antibiotic susceptibility profiles

  • Screen for small molecule inhibitors using transport assays

  • Evaluate synergy between potential inhibitors and existing antibiotics

  • Test efficacy in relevant infection models

This research direction could potentially identify novel therapeutic strategies against B. anthracis, particularly important given the pathogen's bioterrorism potential and the need for alternative treatment options beyond conventional antibiotics .

What are the most promising research applications for recombinant BAMEG_5613 protein beyond basic characterization studies?

Recombinant BAMEG_5613 offers numerous applications beyond basic characterization, with several promising research directions:

Immunological Applications:

  • Vaccine Development

    • As a component in multi-antigen vaccines alongside protective antigen (PA)

    • For generating neutralizing antibodies against B. anthracis membrane proteins

    • Potentially enhancing protection against both vegetative cells and spores

  • Diagnostic Development

    • Creation of sensitive detection systems for B. anthracis

    • Development of antibody-based assays for environmental or clinical samples

    • Potential biomarker for monitoring infection progression

Structural Biology Applications:

  • Membrane Protein Research Platform

    • Model system for studying bacterial metal transporters

    • Template for computational design of transport inhibitors

    • Platform for membrane protein crystallization technique development

Biotechnological Applications:

  • Metal Bioremediation

    • Engineered systems incorporating BAMEG_5613 for manganese extraction

    • Development of biosensors for environmental metal detection

    • Potential applications in industrial settings for metal recovery

  • Synthetic Biology Tools

    • As a manganese-responsive genetic circuit component

    • Development of metal-regulated expression systems

    • Creation of bacterial chassis with programmable metal homeostasis

Drug Discovery Applications:

  • Target-Based Screening

    • High-throughput screening platform for antimicrobial discovery

    • Structure-based design of transport inhibitors

    • Identification of allosteric modulators of transport function

Each of these applications builds upon the foundational characterization of BAMEG_5613 and extends its utility across multiple research domains, potentially addressing important challenges in infectious disease management, environmental science, and biotechnology .

How should researchers integrate findings about BAMEG_5613 with broader studies of Bacillus anthracis pathogenesis?

Integrating BAMEG_5613 research into the broader understanding of B. anthracis pathogenesis requires a multidisciplinary approach that connects molecular mechanisms to disease progression:

Systems Biology Integration:

Translational Research Approaches:

  • Animal Model Studies

    • Compare infection progression between wild-type and BAMEG_5613 mutant strains

    • Evaluate tissue-specific expression patterns during different infection stages

    • Correlate BAMEG_5613 activity with bacterial dissemination and survival

  • Therapeutic Development Pipeline

    • Screen for compounds targeting both BAMEG_5613 and traditional virulence factors

    • Evaluate combination approaches targeting multiple pathogenesis pathways

    • Develop diagnostic markers that include BAMEG_5613 detection

Collaborative Research Framework:

To effectively integrate BAMEG_5613 research with broader pathogenesis studies, researchers should establish:

  • Standardized Experimental Protocols

    • Consistent methodologies for studying protein function across laboratories

    • Shared resources including antibodies, recombinant proteins, and mutant strains

    • Common reporting formats for metal transport data

  • Interdisciplinary Collaborations

    • Connect membrane protein biochemists with immunologists and infection biologists

    • Engage computational biologists for modeling metal transport impacts on virulence

    • Partner with structural biologists to inform function-based studies

  • Comprehensive Research Database

    • Establish repositories for BAMEG_5613-related data

    • Link findings to existing B. anthracis pathogenesis databases

    • Develop predictive tools based on accumulated data

This integrated approach ensures that discoveries regarding BAMEG_5613's role in metal homeostasis are contextualized within the broader understanding of B. anthracis pathogenesis, potentially revealing new intervention points and contributing to more effective countermeasures against anthrax .

What are the optimal protocols for generating and validating antibodies against BAMEG_5613 for research applications?

Generating high-quality antibodies against membrane proteins like BAMEG_5613 presents unique challenges requiring specialized approaches:

Antigen Preparation Strategies:

  • Recombinant Protein Fragments

    • Express hydrophilic loops or domains (avoiding transmembrane regions)

    • Use His-tagged constructs for purification

    • Ensure proper folding through circular dichroism analysis

    • Recommended expression system: E. coli with solubility-enhancing fusion partners

  • Synthetic Peptide Approach

    • Design peptides from predicted extracellular/periplasmic regions

    • Select 15-20 amino acid sequences with high antigenicity scores

    • Conjugate to carrier proteins (KLH or BSA) to enhance immunogenicity

    • Use multiple peptides targeting different regions for comprehensive coverage

Immunization Protocol:

StepPolyclonal Antibody ProductionMonoclonal Antibody Production
Animal SelectionRabbits (preferred), GoatsBALB/c mice
Initial Immunization200-500 μg antigen with complete Freund's adjuvant50-100 μg antigen with complete Freund's adjuvant
Booster ScheduleDays 14, 28, 42 with incomplete Freund's adjuvantDays 14, 28 with incomplete Freund's adjuvant
Sample CollectionTrial bleed at day 35, final collection at day 56Spleen harvest at day 35 for hybridoma production
Adjuvant OptionsAlhydrogel or Montanide ISA 720 as alternativesSame alternatives

Validation Methods:

  • Primary Validation

    • ELISA against immunizing antigen (titer determination)

    • Western blot against recombinant protein and B. anthracis lysates

    • Immunoprecipitation to confirm native protein recognition

  • Specificity Testing

    • Testing against BAMEG_5613 knockout strains (negative control)

    • Cross-reactivity assessment with homologous proteins

    • Peptide competition assays to confirm epitope specificity

  • Functional Validation

    • Immunofluorescence microscopy to confirm cellular localization

    • Flow cytometry to quantify surface exposure

    • Transport activity assays with and without antibody binding

Quality Control Metrics:

  • Minimum acceptable ELISA titer: >1:10,000 for polyclonal, >1:1,000 for monoclonal

  • Western blot should show single band at expected molecular weight (approximately 20 kDa)

  • Immunofluorescence should show membrane localization pattern

  • Batch-to-batch consistency validation for long-term studies

These protocols will generate reliable antibody reagents for BAMEG_5613 research, enabling studies of protein expression, localization, and function in various experimental systems .

What specialized techniques are necessary for studying membrane protein interactions between BAMEG_5613 and potential binding partners?

Investigating interactions between membrane proteins like BAMEG_5613 and potential binding partners requires specialized techniques that preserve native membrane environments and detect often transient or weak interactions:

In Vitro Interaction Analysis:

  • Membrane-Based Pull-Down Assays

    • Solubilize BAMEG_5613 in mild detergents (DDM, CHAPS)

    • Immobilize on affinity resin via His-tag

    • Incubate with cellular lysates or purified candidate partners

    • Elute and analyze by mass spectrometry

    • Critical controls: Non-specific binding to resin, irrelevant membrane protein controls

  • Crosslinking Mass Spectrometry (XL-MS)

    • Apply membrane-permeable crosslinkers to stabilize transient interactions

    • Digest crosslinked complexes and analyze by tandem mass spectrometry

    • Identify interaction interfaces through crosslinked peptide mapping

    • Advantage: Captures weak or transient interactions often missed by other methods

  • Surface Plasmon Resonance (SPR)

    • Immobilize BAMEG_5613 on sensor chips with captured nanodiscs or liposomes

    • Measure real-time binding kinetics of potential partners

    • Determine association/dissociation constants (ka, kd, KD)

    • Challenge: Maintaining protein orientation and accessibility

In Situ and In Vivo Approaches:

  • Proximity Labeling

    • Generate BAMEG_5613 fusions with BioID or APEX2 enzymes

    • Express in B. anthracis or model systems

    • Activate enzyme to biotinylate proximal proteins

    • Isolate biotinylated proteins and identify by mass spectrometry

    • Advantage: Identifies spatial proximity in native cellular environment

  • Förster Resonance Energy Transfer (FRET)

    • Create fluorescent protein fusions with BAMEG_5613 and candidate partners

    • Measure energy transfer as indication of protein proximity (<10 nm)

    • Analyze by microscopy or flow cytometry

    • Challenge: Ensuring fluorescent tags don't disrupt native interactions

  • Split Reporter Systems

    • Fuse BAMEG_5613 and potential partners to complementary fragments of reporters (luciferase, GFP)

    • Signal generated only upon protein-protein interaction

    • Can be adapted for high-throughput screening

    • Advantage: Allows live-cell monitoring of dynamic interactions

Data Integration Framework:

To comprehensively map BAMEG_5613 interactions, researchers should:

  • Begin with unbiased approaches (proximity labeling, XL-MS) to identify candidate interactors

  • Validate high-confidence candidates using orthogonal methods (FRET, SPR)

  • Characterize functional significance through mutagenesis and functional assays

  • Map interaction interfaces using crosslinking or hydrogen-deuterium exchange mass spectrometry

This multilayered approach accounts for the technical challenges of membrane protein interaction studies while providing robust validation through complementary methodologies .

What computational tools and databases are most valuable for researchers studying BAMEG_5613 structure and function?

Researchers investigating BAMEG_5613 can leverage numerous bioinformatic resources to predict structural features, analyze evolutionary relationships, and gain functional insights:

Structural Prediction and Analysis:

  • Membrane Protein Structure Prediction

    • AlphaFold2: State-of-the-art protein structure prediction, particularly valuable for membrane proteins

    • TMHMM/HMMTOP: Transmembrane helix prediction tools

    • PSIPRED: Secondary structure prediction

    • PredictProtein: Comprehensive protein feature prediction suite

  • Structural Visualization and Analysis

    • PyMOL/Chimera: Visualization and analysis of 3D protein structures

    • MDWeb: Molecular dynamics simulation setup for membrane proteins

    • PPM server: Positioning of proteins in membrane calculations

Sequence Analysis and Evolution:

  • Homology and Conservation Analysis

    • BLAST/HMMER: Sequence similarity searches against protein databases

    • ConSurf: Evolutionary conservation analysis mapped to protein structure

    • CLANS: Visualization of protein sequence similarity networks

  • Functional Domain Identification

    • InterPro/Pfam: Protein family and domain annotation

    • CDD: Conserved Domain Database for functional annotation

    • CATH/SCOP: Structural classification databases

Metal Binding and Transport Analysis:

  • Metal Binding Site Prediction

    • MetalPredator: Prediction of metal-binding sites

    • MIB: Metal Ion-Binding site prediction

    • TransportDB: Database of membrane transport proteins

  • Functional Residue Identification

    • Evolutionary Trace: Identification of functionally important residues

    • SDPpred: Specificity-determining position prediction for transport specificity

Integrated Resources and Data Repositories:

ResourceURLPrimary Application for BAMEG_5613 Research
UniProthttps://www.uniprot.org/Comprehensive protein annotation (UniProt ID: C3LFJ8)
PDBhttps://www.rcsb.org/Structural homologs and templates
TCDBhttp://www.tcdb.org/Transport protein classification
STRINGhttps://string-db.org/Protein-protein interaction networks
PaThoBacDBhttps://pathobacdb.org/Pathogenic bacteria database with B. anthracis data

Workflow Recommendation:

  • Begin with UniProt entry C3LFJ8 for comprehensive annotation

  • Use AlphaFold2 to generate structural models if experimental structures unavailable

  • Apply TMHMM to map transmembrane topology

  • Identify potential metal-binding residues with MetalPredator

  • Compare with homologs using ConSurf to identify conserved functional regions

  • Employ molecular dynamics simulations to study metal transport mechanisms

These computational resources provide valuable starting points for experimental design and data interpretation, enabling researchers to generate testable hypotheses about BAMEG_5613 structure and function .

Where can researchers access validated reagents and protocols for BAMEG_5613 research?

Accessing reliable reagents and standardized protocols is essential for reproducible BAMEG_5613 research. The following resources provide validated materials and methods:

Commercial Reagent Sources:

Protocol Repositories:

  • Expression and Purification Protocols

    • Guidelines for BAMEG_5613 reconstitution: Reconstitute in deionized sterile water to 0.1-1.0 mg/mL; add glycerol to 50% final concentration for long-term storage

    • Storage recommendations: Store at -20°C/-80°C upon receipt; aliquot to avoid freeze-thaw cycles; working aliquots can be stored at 4°C for up to one week

  • Functional Assay Protocols

    • Cell binding assays: Protocols for incubating protein with RAW 264.7 cells (5μg/ml for 1 hour at 37°C) followed by detection with specific antibodies

    • Metal transport assays: Methodologies adaptable from studies on related manganese transporters

Research Collaborations and Material Sharing:

  • Academic Collaborations

    • B. anthracis research community maintains collaborative networks that share reagents and protocols

    • Consider contacting authors of key BAMEG_5613 publications for materials transfer agreements

  • Strain and Vector Repositories

    • Bacillus Genetic Stock Center (BGSC): Source for B. anthracis strains and mutants

    • Addgene: Repository for recombinant plasmids and expression vectors

    • BEI Resources: Provides authenticated bacterial strains and reagents for biodefense research

Quality Control Considerations:

When obtaining BAMEG_5613 reagents, researchers should verify:

  • Protein identity via mass spectrometry or N-terminal sequencing

  • Purity through SDS-PAGE analysis (should exceed 90%)

  • Functionality through binding or transport assays

  • Batch-to-batch consistency for long-term studies

Biosafety Considerations:

Research involving B. anthracis components requires appropriate biosafety measures:

  • Most recombinant protein work can be conducted at BSL-1

  • Studies with viable B. anthracis strains require BSL-3 facilities

  • Always follow institutional biosafety committee guidelines and national regulations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.