Recombinant Bacillus anthracis UPF0295 protein BAA_0600 (BAA_0600)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

BAA_0600 is expressed in E. coli using a His-tagged expression vector, enabling affinity chromatography purification. The protein is lyophilized and provided in a sterile, ready-to-use format. Key specifications include:

  • Form: Lyophilized powder.

  • Stability: Stable at -20°C/-80°C when stored properly.

  • Handling Notes: Repeated freezing/thawing is discouraged; store working aliquots at 4°C for short-term use .

Functional Insights and Pathways

While BAA_0600 is annotated as a UPF0295 family protein, its specific biochemical functions remain poorly characterized in available literature. Limited data suggest potential involvement in pathways related to B. anthracis survival or pathogenicity, though no direct functional studies (e.g., enzymatic activity or interaction networks) are reported.

Key Observations:

  • Pathway Involvement: No validated pathways are listed in current databases .

  • Interacting Proteins: No experimentally confirmed interactions are documented .

  • Role in Anthrax: Unlike protective antigen (PA) or spore proteins (e.g., BclA, BxpB), BAA_0600 is not directly linked to toxin production or immune evasion mechanisms .

Research Applications

BAA_0600 serves primarily as a research reagent for studying B. anthracis protein interactions, spore biology, or pathogenicity mechanisms. Potential applications include:

  1. Structural Studies: Investigating the UPF0295 family’s role in bacterial physiology.

  2. Antigen Screening: Testing BAA_0600 as a candidate in vaccine or diagnostic assays (though no efficacy data exists).

  3. Protein-Protein Interactions: Identifying binding partners using co-IP or pull-down assays.

Limitations and Gaps

  • Functional Data: No published studies describe BAA_0600’s enzymatic activity, localization, or role in B. anthracis infection.

  • Vaccine Relevance: Unlike PA or spore antigens (e.g., BxpB), BAA_0600 is not implicated in immune protection or toxin neutralization .

  • Experimental Validation: Further studies are required to elucidate its biological significance.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its use in production.
Synonyms
BAA_0600; UPF0295 protein BAA_0600
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bacillus anthracis (strain A0248)
Target Names
BAA_0600
Target Protein Sequence
MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEGKEFDEKYNKKSYKS
Uniprot No.

Target Background

Database Links

KEGG: bai:BAA_0600

Protein Families
UPF0295 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.