Recombinant Bacillus anthracis UPF0295 protein BAMEG_4067 (BAMEG_4067)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Bacillus anthracis UPF0295 protein BAMEG_4067 belongs to the UPF0295 protein family, where "UPF" designates an Uncharacterized Protein Family. This classification indicates that while the protein has been identified and sequenced, its precise biological functions remain to be fully elucidated. The protein originates from Bacillus anthracis, the gram-positive, spore-forming bacterium that causes anthrax, a serious infectious disease affecting both humans and animals .

The recombinant form of BAMEG_4067 has been produced to facilitate various research applications, providing scientists with a tool to investigate the structural and functional properties of this bacterial protein. As part of the ongoing research into B. anthracis, this protein represents a potential avenue for enhancing our understanding of bacterial physiology and pathogenesis.

Table 1: Basic Properties of BAMEG_4067

PropertyCharacteristic
Protein NameUPF0295 protein BAMEG_4067
Gene NameBAMEG_4067
OrganismBacillus anthracis (strain CDC 684 / NRRL 3495)
Length118 amino acids
UniProt IDC3LH93
Protein FamilyUPF0295
FormLyophilized powder
Purity>90% by SDS-PAGE

Production and Purification Methodologies

The recombinant BAMEG_4067 protein is produced through heterologous expression in Escherichia coli. The full-length protein (amino acids 1-118) is expressed with an N-terminal histidine tag, which facilitates efficient purification using affinity chromatography techniques .

The production process involves cloning the BAMEG_4067 gene into an appropriate expression vector, transforming E. coli with this construct, inducing protein expression, and subsequently purifying the target protein from bacterial lysates. Following expression and purification, the protein is typically supplied in a lyophilized powder form with a purity exceeding 90%, as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) analysis .

Table 2: Production and Purification Details

ParameterDescription
Expression HostEscherichia coli
TagN-terminal His-tag
Expression Region1-118 (full length)
Purification MethodAffinity chromatography
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Alternative BufferTris-based buffer, 50% glycerol, optimized for this protein
Final Product FormLyophilized powder

Comparative Analysis with Other B. anthracis Proteins

While BAMEG_4067 is less studied than the major virulence factors of B. anthracis such as protective antigen (PA), lethal factor (LF), and edema factor (EF), understanding its potential role in bacterial physiology can provide valuable insights into anthrax pathogenesis.

Unlike the well-characterized toxin components that have defined roles in anthrax pathogenesis, BAMEG_4067 belongs to the UPF0295 family with uncertain function. The major toxin components of B. anthracis operate together to form the lethal toxin (PA+LF) and edema toxin (PA+EF), which target host cells through specific receptors like TEM8 and CMG2 .

The cellular localization of BAMEG_4067 can be inferred from its amino acid sequence, which suggests it may be a membrane-associated protein based on its hydrophobic regions . This contrasts with the secreted nature of the anthrax toxin components and is more reminiscent of surface layer proteins like EA1 and Sap that have structural roles in B. anthracis .

Research Applications and Potential Significance

While the specific biological function of BAMEG_4067 in Bacillus anthracis remains to be fully characterized, the recombinant protein has several important applications in research:

  1. Structural Biology Studies: The purified protein can be used for crystallographic or NMR studies to determine its three-dimensional structure, which could provide insights into its function .

  2. Protein-Protein Interaction Analysis: Identifying potential binding partners or complexes formed by BAMEG_4067 in bacterial cells could reveal its role in cellular processes .

  3. Antibody Development: The recombinant protein can serve as an antigen for generating specific antibodies useful for detection and localization studies .

  4. Functional Assays: Investigating any potential enzymatic activities or biochemical functions through in vitro assays could clarify the protein's role in bacterial physiology .

  5. Immunological Research: The protein could be used to study host immune responses to B. anthracis components, potentially contributing to vaccine development research .

The recombinant BAMEG_4067 protein is commercially available for research purposes only and is not intended for human consumption or diagnostic applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
BAMEG_4067; UPF0295 protein BAMEG_4067
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bacillus anthracis (strain CDC 684 / NRRL 3495)
Target Names
BAMEG_4067
Target Protein Sequence
MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEGKEFDEKYNKKSYKS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0295 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.