Recombinant Bacillus anthracis UPF0316 protein BAA_3454 (BAA_3454)

What is the Bacillus anthracis UPF0316 protein BAA_3454?

The BAA_3454 is a protein belonging to the UPF0316 family found in Bacillus anthracis, the causative agent of anthrax. It is a full-length protein consisting of 182 amino acids and has been assigned the UniProt ID C3P314. The protein is classified as part of the UPF (Uncharacterized Protein Family) 0316 group, indicating that its precise biological function has not been fully elucidated, though structural predictions suggest membrane-associated properties. The recombinant versions of this protein are typically produced with tags (such as His-tag) to facilitate purification and are used in various research applications related to B. anthracis .

The protein's hydrophobic amino acid composition suggests it may be membrane-associated, which is consistent with its predicted transmembrane domains. The presence of specific motifs within its sequence indicates potential involvement in cellular processes that may be relevant to the pathogenicity or survival mechanisms of B. anthracis. Understanding this protein could provide insights into bacterial physiology and potential targets for therapeutic intervention .

What is the complete amino acid sequence of BAA_3454?

The complete amino acid sequence of BAA_3454 from Bacillus anthracis is:

MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAAVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHHVS

This 182-amino acid sequence contains several hydrophobic regions, particularly in the N-terminal portion, which is consistent with its predicted membrane localization. The sequence contains multiple transmembrane domains, as evidenced by the stretches of hydrophobic residues. Analyzing this sequence through bioinformatics tools can reveal potential functional domains, secondary structure predictions, and evolutionary relationships with proteins from other organisms. Researchers can utilize this sequence information for designing primers for cloning, generating specific antibodies, or performing in silico structural analyses .

What experimental applications is recombinant BAA_3454 suitable for?

Recombinant BAA_3454 has proven valuable across multiple experimental applications in B. anthracis research. Based on current literature and product information, the protein has been successfully employed in the following research contexts:

• Immunological Studies: The recombinant protein serves as an antigen for antibody production and immunization experiments. It has been utilized in ELISA-based assays to detect and quantify specific antibody responses. These applications are particularly relevant when investigating the immune response to B. anthracis exposure or vaccination .

• Western Blotting: BAA_3454 can be used as a positive control or as a target antigen in Western blot analyses. This application enables researchers to validate antibody specificity, assess protein expression levels, or investigate protein-protein interactions involving BAA_3454 .

• Structural Biology: The availability of highly purified recombinant BAA_3454 facilitates structural studies using techniques such as X-ray crystallography, nuclear magnetic resonance (NMR) spectroscopy, or cryo-electron microscopy. These approaches help elucidate the three-dimensional structure of the protein, providing insights into its potential function .

• Vaccine Development Research: In conjunction with appropriate adjuvants, BAA_3454 can be investigated as a potential component of subunit vaccines against B. anthracis. The protein may be incorporated into delivery systems such as nanolipoprotein particles (NLPs) for immunization studies, particularly for intranasal vaccination approaches .

When designing experiments utilizing BAA_3454, researchers should consider the protein's membrane-associated nature, which may affect solubility and stability under different buffer conditions. Additionally, the presence of tags (such as His-tag) should be evaluated for potential interference with specific experimental endpoints .

What are the recommended storage and handling conditions for optimal stability?

Proper storage and handling of recombinant BAA_3454 are critical to maintain protein integrity and functionality. Based on empirical data and manufacturer recommendations, the following guidelines should be observed:

For lyophilized protein:

• Store at -20°C or -80°C upon receipt

• Expected shelf life is approximately 12 months when stored properly at -20°C/-80°C

• Avoid exposure to repeated freeze-thaw cycles

• Prior to opening, briefly centrifuge the vial to bring contents to the bottom

For reconstituted protein:

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (typically 50% is recommended) for long-term storage

• Store working aliquots at 4°C for up to one week

• For extended storage, prepare small aliquots and store at -20°C or -80°C

• Storage buffer typically consists of a Tris-based buffer with 50% glycerol, pH 8.0

When handling the protein, it is important to avoid repeated freeze-thaw cycles as these can lead to protein denaturation and aggregation. For experiments requiring multiple uses, it is advisable to prepare small, single-use aliquots. The presence of trehalose (6%) in some storage formulations has been shown to enhance stability by preventing protein aggregation during freeze-thaw cycles .

For applications requiring buffer exchange, gentle methods such as dialysis or size exclusion chromatography are preferred over harsher techniques that might compromise protein structure. The stability of BAA_3454 in various buffer conditions should be empirically determined if the experimental design necessitates conditions substantially different from the recommended storage buffer .

What reconstitution protocols are recommended for lyophilized BAA_3454?

Proper reconstitution of lyophilized BAA_3454 is essential to ensure protein functionality and minimize aggregation. The following step-by-step protocol is recommended based on manufacturer guidelines and experimental best practices:

• Centrifugation: Briefly centrifuge the vial prior to opening to bring the contents to the bottom and prevent loss of material.

• Initial Reconstitution: Add deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL. The exact volume will depend on the amount of lyophilized protein in the vial. Add water slowly to the side of the vial rather than directly onto the lyophilized cake.

• Gentle Mixing: Allow the protein to dissolve by gentle inversion or rotation. Avoid vigorous vortexing or pipetting, which can lead to protein denaturation or aggregation due to the protein's hydrophobic regions.

• Glycerol Addition: For long-term storage, add glycerol to a final concentration between 5-50% (typically 50% is recommended). Glycerol acts as a cryoprotectant, preventing damage during freeze-thaw cycles.

• Aliquoting: Divide the reconstituted protein into small, single-use aliquots to avoid repeated freeze-thaw cycles. Label each aliquot with the protein concentration, date of reconstitution, and any additives present .

For specialized applications, additional considerations may apply. For example, if the protein will be used in cell culture experiments, sterile filtration may be necessary. Similarly, if the protein will be used in crystallization trials, the glycerol concentration might need to be reduced or eliminated through buffer exchange processes.

When using reconstituted BAA_3454 for analytical techniques such as SDS-PAGE, Western blotting, or ELISA, further dilution in appropriate assay buffers may be required. The compatibility of these buffers with BAA_3454 should be verified to prevent protein precipitation or denaturation .

What is known about the function of BAA_3454 in B. anthracis biology?

The precise biological function of BAA_3454 in Bacillus anthracis remains incompletely characterized, presenting an active area for research. As a member of the UPF0316 protein family, its function has been primarily inferred through bioinformatic analyses and structural predictions rather than direct experimental evidence. The protein's amino acid sequence suggests multiple transmembrane domains, indicating it likely resides in the bacterial membrane. This localization points to potential roles in membrane integrity, transport processes, or cell signaling pathways.

The hydrophobic nature of BAA_3454's N-terminal region (MLQALLIFVLQIIYVPILTIR) strongly suggests a membrane-anchoring function. The presence of charged residues distributed throughout the sequence may facilitate interactions with other proteins or molecular components of the bacterial cell. Comparative genomic analyses indicate conservation of UPF0316 family proteins across various Bacillus species, suggesting an important, though currently undetermined, role in bacterial physiology .

Recent research on B. anthracis has increasingly focused on membrane proteins as potential targets for antimicrobial development and vaccine strategies. While BAA_3454 has not been explicitly linked to virulence, its membrane localization makes it a candidate for further investigation in pathogenesis studies. The protein may contribute to the bacterium's adaptation to different environmental conditions or host environments during infection. Researchers exploring the function of BAA_3454 might consider techniques such as gene knockout/knockdown studies, protein-protein interaction assays, or localization studies using fluorescently-tagged constructs to elucidate its biological role .

How might BAA_3454 contribute to vaccine development strategies?

While BAA_3454 is not among the most extensively studied B. anthracis antigens for vaccine development, emerging research suggests potential applications in multi-component vaccine strategies. The protein's membrane localization makes it accessible to the host immune system, potentially eliciting specific antibody responses that could contribute to protective immunity. Research on B. anthracis vaccination has traditionally focused on more characterized antigens such as protective antigen (PA), but there is growing interest in exploring additional bacterial components to enhance vaccine efficacy.

Recent studies have investigated nanolipoprotein particles (NLPs) containing the Toll-like receptor 4 agonist monophosphoryl lipid A (MPLA) as a platform for intranasal vaccination against B. anthracis. This approach enables the attachment of multiple spore and toxin protein antigens, creating potential for multivalent vaccine preparations. Similar methodologies could be applied to incorporate BAA_3454 into such vaccine candidates, particularly if this protein is found to be immunogenic or to provide complementary protection when combined with established antigens .

For researchers exploring BAA_3454 as a vaccine component, several methodological approaches may be considered:

• Antigen Formulation: BAA_3454 could be incorporated into various delivery systems, including nanolipoprotein particles, liposomes, or adjuvanted formulations. The hydrophobic nature of the protein may facilitate its incorporation into lipid-based delivery systems.

• Route of Administration: Evaluation of different immunization routes (intranasal, subcutaneous, intramuscular) to determine optimal delivery for eliciting protective responses against BAA_3454.

• Immune Response Assessment: Characterization of both humoral (antibody) and cellular immune responses to BAA_3454, with particular attention to mucosal immunity for respiratory protection against B. anthracis spores.

• Combination Strategies: Testing BAA_3454 in combination with established B. anthracis antigens to assess potential synergistic protection .

The development of a successful vaccine incorporating BAA_3454 would require extensive preclinical testing followed by clinical trials to establish safety and efficacy. The protein's conservation across B. anthracis strains should be thoroughly evaluated to ensure broad protection against diverse isolates.

What analytical methods are recommended for assessing BAA_3454 quality and functionality?

Comprehensive quality assessment of recombinant BAA_3454 requires multiple analytical techniques to evaluate purity, identity, structure, and functional properties. The following methodological approaches are recommended for researchers working with this protein:

Purity Assessment:

• SDS-PAGE: Standard method for evaluating protein purity, typically showing >85-90% purity for commercial preparations. Both reducing and non-reducing conditions should be tested to assess potential disulfide bonding.

• Size Exclusion Chromatography (SEC): Allows detection of aggregates, oligomers, and degradation products. Analytical SEC using a Superdex 200 Increase column in PBS at a flow rate of 0.2 ml/min has been successfully applied for similar proteins.

• Reverse-Phase HPLC: Provides additional resolution for detecting impurities or truncated forms of the protein .

Identity Confirmation:

• Mass Spectrometry: Peptide mass fingerprinting after tryptic digestion can confirm the identity of BAA_3454 and detect potential post-translational modifications.

• Western Blotting: Using antibodies specific to BAA_3454 or to the tag (e.g., anti-His antibody) can confirm protein identity.

• N-terminal Sequencing: Edman degradation can verify the correct N-terminal sequence, particularly important for confirming proper processing of signal peptides or tags .

Structural Characterization:

• Circular Dichroism (CD): Provides information about secondary structure content (α-helices, β-sheets) and can be used to monitor structural changes under different conditions.

• Fourier Transform Infrared Spectroscopy (FTIR): Complements CD data for structural characterization, particularly useful for membrane proteins.

• Dynamic Light Scattering (DLS): Evaluates size distribution and potential aggregation states in solution .

Functional Assays:

• Binding Assays: If specific binding partners are identified, surface plasmon resonance (SPR) or biolayer interferometry (BLI) can characterize binding kinetics.

• Immunological Assays: Evaluation of immunogenicity through ELISA or other immunoassays can assess the protein's ability to elicit specific antibody responses.

• Stability Studies: Monitoring protein stability under various conditions (temperature, pH, buffer composition) using techniques such as differential scanning fluorimetry (DSF) .

For membrane proteins like BAA_3454, additional considerations include assessing proper folding and maintenance of native conformation. The presence of the His-tag or other fusion elements should be evaluated for potential impacts on protein structure and function. In some cases, removal of the tag may be necessary for certain applications, requiring optimization of proteolytic cleavage conditions and subsequent purification steps .

How can researchers optimize ELISA protocols using recombinant BAA_3454?

Enzyme-Linked Immunosorbent Assay (ELISA) is a versatile technique for detecting and quantifying antibodies against BAA_3454 or for evaluating the protein's immunogenicity. Optimizing ELISA protocols specifically for this protein requires attention to several key parameters:

Coating Conditions:

• Concentration Optimization: Typical coating concentrations range from 1-5 μg/ml of recombinant BAA_3454. A titration experiment (0.5, 1, 2, 5 μg/ml) should be performed to determine optimal coating concentration that provides maximum signal with minimal background.

• Buffer Selection: Due to the hydrophobic nature of BAA_3454, standard carbonate/bicarbonate buffer (pH 9.6) may not be optimal. Testing alternative coating buffers such as PBS (pH 7.4) or Tris-buffered saline (pH 8.0) is recommended.

• Incubation Parameters: Coating can be performed overnight at 4°C or for 2 hours at room temperature. The optimal condition should be determined empirically .

Blocking Strategy:

• Blocking Agent Selection: BSA (1-3%) or non-fat dry milk (5%) in PBS with 0.05% Tween-20 (PBST) are commonly used. For BAA_3454, which contains hydrophobic regions, the addition of 0.1% Triton X-100 to the blocking buffer may reduce non-specific binding.

• Blocking Duration: 1-2 hours at room temperature is typically sufficient, though optimization may be required for specific antibody combinations .

Detection System:

• Primary Antibody Dilution: For anti-BAA_3454 antibodies, a titration series (1:100 to 1:10,000) should be tested to determine optimal dilution that maximizes specific signal while minimizing background.

• Secondary Antibody Selection: HRP-conjugated or AP-conjugated secondary antibodies specific to the primary antibody species should be used at manufacturer-recommended dilutions, typically 1:2,000 to 1:10,000.

• Substrate Choice: TMB (3,3',5,5'-Tetramethylbenzidine) is commonly used for HRP-based detection systems, while pNPP (p-Nitrophenyl phosphate) is suitable for AP-based systems .

Assay Validation:

• Positive and Negative Controls: Include wells with known positive sera (from immunized animals) and negative controls (pre-immune sera) to establish assay performance parameters.

• Standard Curve Generation: If quantification is required, a standard curve using purified antibodies of known concentration should be included.

• Reproducibility Assessment: Intra-assay and inter-assay variation should be determined through replicate testing to establish assay reliability .

A typical optimized ELISA protocol might include:

• Coating plates with 2 μg/ml BAA_3454 in PBS overnight at 4°C

• Blocking with 2% BSA in PBST with 0.1% Triton X-100 for 2 hours at room temperature

• Primary antibody incubation at optimized dilution for 1-2 hours at room temperature

• Secondary antibody incubation at 1:5,000 dilution for 1 hour at room temperature

• Development with appropriate substrate and measurement at the optimal wavelength (450 nm for TMB) .

What approaches can be used to study BAA_3454 in the context of host-pathogen interactions?

Investigating BAA_3454 in host-pathogen interactions requires multidisciplinary approaches that combine molecular, cellular, and immunological techniques. Several methodological strategies can be employed to elucidate the protein's role in B. anthracis pathogenesis and host immune responses:

Infection Models:

• Cell Culture Systems: Human or animal cell lines relevant to B. anthracis infection (e.g., macrophages, dendritic cells, lung epithelial cells) can be exposed to purified BAA_3454 or to bacterial strains with modified BAA_3454 expression. Changes in host cell transcriptome, proteome, or cytokine production can be assessed.

• Animal Models: Mice, guinea pigs, or rabbits can be used to study immune responses to BAA_3454 in the context of vaccination or infection. These models allow evaluation of antibody responses, T cell activation, and protective efficacy against challenge with B. anthracis spores .

Molecular Interaction Studies:

• Protein-Protein Interaction Assays: Techniques such as pull-down assays, co-immunoprecipitation, or yeast two-hybrid systems can identify host proteins that interact with BAA_3454. These interactions may provide insights into the protein's role in pathogenesis.

• Surface Plasmon Resonance (SPR): This technique can quantitatively measure binding kinetics between BAA_3454 and potential host receptors or immune components (e.g., complement proteins, antibodies).

• Fluorescence Microscopy: Fluorescently labeled BAA_3454 can be used to track its localization during host cell interaction and identify specific cellular compartments where the protein may function .

Immune Response Characterization:

• Antibody Profiling: ELISA, Western blotting, or protein microarrays can be used to characterize antibody responses to BAA_3454 in infected or immunized subjects. Epitope mapping can identify immunodominant regions of the protein.

• T Cell Response Analysis: ELISpot assays or flow cytometry-based intracellular cytokine staining can assess T cell responses to BAA_3454-derived peptides, identifying potential T cell epitopes.

• Cytokine Profiling: Multiplex cytokine assays can measure inflammatory and immune-regulatory cytokines produced in response to BAA_3454 exposure .

Genetic Manipulation Approaches:

• Gene Knockout/Knockdown: Creating B. anthracis strains with deleted or reduced BAA_3454 expression can reveal the protein's contribution to bacterial survival, growth, or virulence in infection models.

• Complementation Studies: Reintroducing the BAA_3454 gene into knockout strains can confirm phenotypic observations and rule out polar effects of genetic manipulation.

• Site-Directed Mutagenesis: Introducing specific mutations in BAA_3454 can identify functionally important residues or domains involved in host-pathogen interactions .

A comprehensive experimental approach might involve first characterizing the immunogenicity of BAA_3454 in animal models, followed by detailed analysis of the protective mechanisms using in vitro and in vivo systems. The protein could be incorporated into advanced delivery systems such as nanolipoprotein particles (NLPs) containing MPLA as an adjuvant, which has shown promise for intranasal vaccination against B. anthracis in previous studies .

Comparative Analysis and Future Directions

The currently limited characterization of BAA_3454 presents numerous opportunities for future research that could significantly advance our understanding of B. anthracis biology and potentially contribute to improved countermeasures against anthrax. Several promising research directions warrant further exploration:

1. Structural Biology:

• Determination of the three-dimensional structure of BAA_3454 through X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy would provide valuable insights into its functional domains and potential interaction interfaces.

• Comparative structural analysis with homologous proteins from other bacterial species could reveal conserved features and suggest functional roles.

• Molecular dynamics simulations could elucidate the protein's behavior in membrane environments and identify conformational changes relevant to its function .

2. Functional Characterization:

• Systematic investigation of BAA_3454's role in bacterial physiology through gene deletion/complementation studies, coupled with phenotypic analysis under various growth conditions.

• Identification of protein-protein interaction partners through techniques such as bacterial two-hybrid systems, cross-linking mass spectrometry, or co-immunoprecipitation.

• Assessment of the protein's potential role in antibiotic resistance, stress responses, or adaptation to host environments .

3. Immunological Studies:

• Comprehensive evaluation of BAA_3454's immunogenicity in various animal models, including characterization of antibody responses and T cell epitope mapping.

• Investigation of the protein's potential as a diagnostic marker for B. anthracis infection or exposure.

• Development and optimization of serological assays based on recombinant BAA_3454 for epidemiological studies or vaccine response monitoring .

4. Advanced Vaccine Strategies:

• Exploration of BAA_3454 as a component of multi-antigen vaccine formulations, potentially in combination with established antigens like PA.

• Development of optimized delivery systems for BAA_3454, such as incorporation into nanolipoprotein particles or other adjuvanted formulations.

• Evaluation of mucosal immunization strategies targeting BAA_3454, particularly for respiratory protection against inhalational anthrax.

• Assessment of cross-protection against diverse B. anthracis strains and potentially related Bacillus species .

5. Biotechnological Applications:

• Exploration of BAA_3454 as a potential carrier protein for conjugate vaccines or as a scaffold for epitope display.

• Development of BAA_3454-based biosensors for detecting specific antibodies or other molecular targets.

• Investigation of the protein's properties for potential applications in synthetic biology or protein engineering .

Pursuing these research directions would require interdisciplinary approaches combining molecular biology, structural biology, immunology, and biotechnology. Collaborative efforts between academic laboratories, government research institutions, and industry partners would facilitate comprehensive characterization of BAA_3454 and maximize its potential applications in both basic science and translational research contexts .