Recombinant Bacillus anthracis UPF0316 protein BAMEG_1207 (BAMEG_1207)

Shipped with Ice Packs
In Stock

Description

Identification of Specific Markers

Comparative proteomics analyses of Bacillus anthracis, cereus, and thuringiensis spores have been conducted to identify proteoforms unique to B. anthracis . Mass spectrometry-based tools offer an efficient approach for discovering and identifying such protein markers .

A marker discovery pipeline was developed using peptide- and protein-centric approaches with liquid chromatography coupled to tandem mass spectrometry experiments, utilizing a high resolution/high mass accuracy LTQ-Orbitrap instrument . This was combined with bioinformatics approaches to highlight novel proteins consistently observed across all investigated B. anthracis spores but absent in B. cereus/thuringiensis spores . The relevance and specificity of these markers to B. anthracis were demonstrated by extending the study to 55 strains, including closely related strains such as B. thuringiensis 9727, and B. cereus biovar anthracis CI, CA strains that possess pXO1- and pXO2-like plasmids .

Under these conditions, a combination of proteomics and genomics approaches confirmed the pertinence of 11 markers . Genes encoding these 11 markers are located on the chromosome, providing additional targets complementary to the commonly used plasmid-encoded markers . A targeted liquid chromatography coupled to tandem mass spectrometry method involving the selection reaction monitoring mode was developed for monitoring the 4 most suitable protein markers, demonstrating its value for high throughput and specific detection of B. anthracis spores within complex samples .

Role of SET Protein (BaSET) in B. anthracis Pathogenesis

The SET protein (BaSET) in B. anthracis plays a role in the pathogenesis of the bacteria, regulating NF-κB activation, septation, and infectivity . BaSET methylates human histone H1, resulting in the repression of NF-κB functions . It is secreted and undergoes nuclear translocation to enhance H1 methylation in B. anthracis-infected macrophages . Deletion of BaSET results in delayed growth kinetics and altered septum formation .

MprF Protein and Resistance to Cationic Antimicrobial Peptides

During inhalational anthrax, Bacillus anthracis survives and replicates in alveolar macrophages, followed by rapid invasion into the host's bloodstream, where it multiplies to cause heavy bacteremia . B. anthracis must defend itself from host immune functions encountered during both the intracellular and the extracellular stages of anthrax infection, including cationic antimicrobial peptides . The genetic determinants of B. anthracis contributing to resistance to these peptides are largely unknown . A B. anthracis gene (BA1486 in the ΔANR strain and BAS1375 in the Sterne strain) was identified, whose inactivation causes hypersusceptibility to cationic antimicrobial peptides . This gene encodes a putative membrane protein homologous to MprF . Inactivation of the B. anthracis MprF orthologue results in the inability to synthesize lysinylated phosphatidylglycerols, which is critical for resistance to cationic antimicrobial peptides .

Human-Bacterial Pathogen Protein Interaction Networks

Bacillus anthracis causes pathogenesis, in part, by evading or suppressing immune responses . A study identified 3,073 human-B. anthracis protein-protein interactions (PPIs) . A significant number of these PPIs contain pathogen proteins that are labeled as "putative", "hypothetical", or "uncharacterized" .

Recombinant Protein Production in B. anthracis

A Bacillus anthracis strain deleted for six proteases serves as an effective host for the production of recombinant proteins . A pXO1-free variant of this six-protease mutant strain, designated BH460, provides an improved host strain for the preparation of recombinant proteins . As an example, BH460 was used to produce recombinant EF, which previously has been difficult to obtain from B. anthracis .

Spore Proteins as Vaccine Antigens

Bacillus anthracis spore proteins are immunogenic in mice, and conjugation to nanolipoprotein particles (NLPs) can significantly enhance antibody responses in both serum and mucosal fluids against several of these proteins . Immunization with a six-antigen MPLA:NLP formulation resulted in significant titers against all antigens, as well as an increase in antigen-specific CD4+ T cells in the lung .

Table 1: Immunogenic Bacillus anthracis spore proteins

ProteinDescription
BclASpore surface protein
BclBSpore surface protein
AlrAlanine racemase
ExsKExosporium protein
EA1Exosporium-associated protein
PAProtective antigen

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol (final concentration) and aliquot at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a particular tag, please specify it in your order; we will prioritize its implementation.
Synonyms
BAMEG_1207; UPF0316 protein BAMEG_1207
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus anthracis (strain CDC 684 / NRRL 3495)
Target Names
BAMEG_1207
Target Protein Sequence
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAAVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHH VS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is BAMEG_1207 and where is it found?

BAMEG_1207 is a protein classified as UPF0316 (Uncharacterized Protein Family 0316) found in Bacillus anthracis, the causative agent of anthrax. B. anthracis is a Gram-positive, spore-forming soil bacterium that is a member of the Bacillus cereus group species. This group also includes B. cereus, B. thuringiensis, B. mycoides, B. pseudomycoides, and B. weihenstephanensis, all of which share similar cell structure and physiology but differ in pathogenicity . BAMEG_1207 is one of numerous proteins expressed by B. anthracis, though its specific function remains under investigation.

What are the key structural characteristics of BAMEG_1207?

BAMEG_1207 is a full-length protein consisting of 182 amino acids (1-182). For research purposes, recombinant versions are typically produced with histidine tags to facilitate purification and detection . The protein is commonly expressed in E. coli expression systems for research applications, which allows for the production of significant quantities of the protein for structural and functional studies.

How does BAMEG_1207 fit into B. anthracis biology?

While specific information about BAMEG_1207's exact role in B. anthracis biology is limited in the current literature, it should be understood within the broader context of B. anthracis physiology. B. anthracis has dual lifestyles - pathogenic (in mammalian hosts) and environmental (in soil) . The bacterium produces virulence factors including anthrax toxin proteins and a poly-D-glutamic acid capsule during infection, with genes encoding these factors located on the pXO1 and pXO2 plasmids, respectively . Understanding whether BAMEG_1207 contributes to either lifestyle requires targeted research.

What expression systems are most effective for producing recombinant BAMEG_1207?

E. coli expression systems are the predominant choice for recombinant BAMEG_1207 production . When designing expression protocols, researchers should consider:

  • Codon optimization for E. coli if yields are suboptimal

  • Selection of appropriate fusion tags (His-tag being common for BAMEG_1207)

  • Induction conditions optimization (temperature, IPTG concentration, duration)

  • Cell lysis methods that preserve protein structure

  • Purification strategies compatible with downstream applications

The expression protocol should include proper controls to verify successful expression, including SDS-PAGE and Western blotting to confirm the presence of the correctly sized protein.

What purification strategies work best for BAMEG_1207 protein preparations?

For His-tagged BAMEG_1207, the following purification protocol is recommended:

StepMethodConsiderations
Initial CaptureImmobilized Metal Affinity Chromatography (IMAC)Use Ni-NTA or Co-based resins; optimize imidazole concentration in wash buffers
Intermediate PurificationIon Exchange ChromatographySelect based on theoretical pI of BAMEG_1207
PolishingSize Exclusion ChromatographyAssess oligomeric state and remove aggregates
Quality ControlSDS-PAGE, Western Blot, Mass SpectrometryConfirm purity, identity, and integrity
Activity AssessmentFunctional AssaysDevelop based on predicted function of BAMEG_1207

Each purification step should be optimized to maintain the native structure and function of the protein while removing contaminants and degradation products.

How can researchers verify the integrity of purified BAMEG_1207?

Verification of recombinant BAMEG_1207 integrity should follow a multi-method approach:

  • SDS-PAGE to confirm molecular weight (expected ~20 kDa plus tag size)

  • Western blotting with anti-His antibodies for tagged constructs

  • Mass spectrometry for accurate mass determination and sequence coverage

  • Circular dichroism spectroscopy to assess secondary structure

  • Dynamic light scattering to evaluate homogeneity and aggregation state

These methods collectively provide a comprehensive assessment of protein quality before proceeding to functional or structural studies.

What approaches should be used to elucidate the function of BAMEG_1207?

As an uncharacterized protein, determining BAMEG_1207's function requires multiple complementary approaches:

  • Bioinformatic Analysis:

    • Sequence homology with characterized proteins

    • Structural prediction using AlphaFold or similar tools

    • Genomic context analysis to identify potentially co-regulated genes

  • Experimental Approaches:

    • Gene knockout studies to observe phenotypic changes

    • Protein-protein interaction studies (pull-downs, Y2H, BioID)

    • Transcriptomic analysis comparing wild-type and knockout strains

    • Metabolomic profiling to identify affected pathways

  • Structural Studies:

    • X-ray crystallography or cryo-EM for 3D structure determination

    • NMR for structural dynamics and ligand binding studies

The integration of these approaches can provide converging evidence for functional assignment.

How might BAMEG_1207 contribute to B. anthracis pathogenicity or environmental persistence?

While specific information about BAMEG_1207's contribution to pathogenicity is not directly available in the search results, researchers should investigate:

  • Expression Analysis:

    • Compare BAMEG_1207 expression levels in host-mimicking conditions versus environmental conditions

    • Determine if expression is co-regulated with known virulence factors

  • Host-Pathogen Interaction Studies:

    • Evaluate interaction with host immune components

    • Assess impact on host cell signaling or metabolism

  • Environmental Adaptation Assessment:

    • Test BAMEG_1207 knockout strains for survival under various environmental stresses

    • Investigate potential roles in sporulation or germination processes

Given B. anthracis' dual lifestyle as both a pathogen and soil bacterium, understanding BAMEG_1207's role in either context would provide valuable insights .

What is the relationship between BAMEG_1207 and other proteins in the B. anthracis proteome?

To establish BAMEG_1207's position within the wider B. anthracis proteome network:

  • Interactome Analysis:

    • Conduct co-immunoprecipitation with tagged BAMEG_1207

    • Perform proximity labeling (BioID/APEX) to identify neighboring proteins

    • Use crosslinking mass spectrometry to capture transient interactions

  • Pathway Integration:

    • Map identified interactions onto known B. anthracis pathways

    • Look for enrichment in specific cellular processes

  • Comparative Analysis:

    • Compare interaction networks between growth in host-mimicking and environmental conditions

    • Identify condition-specific interaction partners

Understanding BAMEG_1207's interaction network could reveal functional associations not evident from sequence analysis alone.

How should proteomics experiments be designed to maximize detection of BAMEG_1207 and its interacting partners?

Designing proteomics experiments requires careful consideration of sample complexity and dynamic range. For optimal detection of BAMEG_1207 and its partners:

Design ParameterRecommended ApproachImpact on Success Rate
Protein SeparationFractionate sample to reduce complexity to ~3,000 proteins per fractionSignificant improvement in dynamic range and detection sensitivity
Peptide LoadingIncrease loading amount from 0.1 μg to 10 μg when possibleSubstantial gain in success rate and relative dynamic range
Peptide SeparationEnhance separation to yield 1,000 fractions rather than 100Further improves detection of less abundant proteins
Mass SpectrometryUse high-resolution MS with multiple fragmentation techniquesIncreases confidence in protein identification

According to simulation studies, these optimization steps can enhance proteome analysis success rates by five- to tenfold . The wider the range of protein abundances in your sample, the more critical these optimizations become for detecting lower abundance proteins like BAMEG_1207 or its transient interactors.

What controls should be included when studying BAMEG_1207 function in vitro and in vivo?

Rigorous experimental design requires appropriate controls:

  • In Vitro Studies:

    • Negative control: Empty vector-transformed E. coli or purification from non-expressing cells

    • Positive control: Well-characterized protein from the same family or with similar expected function

    • Stability control: Heat-denatured BAMEG_1207 to control for non-specific effects

    • Tag control: Another protein with identical tag to distinguish tag-specific from protein-specific effects

  • In Vivo Studies:

    • Wild-type B. anthracis (positive control)

    • BAMEG_1207 knockout strain

    • Complemented knockout strain (to confirm phenotype rescue)

    • Strain expressing catalytically inactive BAMEG_1207 (if enzymatic function is suspected)

  • Interaction Studies:

    • Beads-only control for pull-down experiments

    • Unrelated protein control with same tag

    • Competition assays with untagged protein to confirm specificity

These controls help distinguish specific BAMEG_1207-mediated effects from artifacts or indirect consequences.

How can researchers overcome the challenges of studying proteins from BSL-3 pathogens like B. anthracis?

Studying BAMEG_1207 presents biosafety challenges due to B. anthracis' classification as a BSL-3 pathogen:

  • Alternative Expression Systems:

    • Express recombinant BAMEG_1207 in non-pathogenic hosts like E. coli

    • Use attenuated B. anthracis strains lacking virulence plasmids

    • Consider B. cereus as a surrogate if homologous proteins exist

  • Biosafety Considerations:

    • Work with recombinant protein rather than live organisms when possible

    • Collaborate with BSL-3 facilities for experiments requiring live B. anthracis

    • Design experiments to minimize handling of infectious material

  • In Silico Approaches:

    • Leverage computational predictions for initial hypothesis generation

    • Use molecular modeling to predict structure-function relationships

    • Perform comparative genomics with non-pathogenic relatives

These approaches allow meaningful research on BAMEG_1207 while maintaining appropriate biosafety standards.

How should researchers visualize and present BAMEG_1207 experimental data for maximum impact?

Effective data presentation enhances comprehension and impact. The appropriate visualization depends on the data type:

  • For expression data and purification yields:

    • Bar graphs comparing different conditions, with error bars representing standard deviation

    • Include sorting for clear comparative analysis

  • For protein-protein interaction networks:

    • Network diagrams with BAMEG_1207 as the central node

    • Edge thickness representing interaction strength

  • For functional assays over time:

    • Line graphs showing trends or relationships between variables

    • Include appropriate statistical analysis

  • For structural data:

    • Ribbon diagrams highlighting key functional domains

    • Surface representations showing electrostatic potential

  • For comparative analyses:

    • Tables presenting systematic overviews of results when precise numerical values are important

    • Heat maps for large-scale comparisons

Each visualization should include comprehensive legends and clear labeling to ensure interpretability by peers.

How can conflicting results in BAMEG_1207 research be reconciled?

When facing contradictory findings about BAMEG_1207:

  • Methodological Differences:

    • Compare experimental conditions (pH, temperature, buffer composition)

    • Assess protein preparation methods (tags, purification approach)

    • Evaluate detection methods and their sensitivity limits

  • Biological Variables:

    • Check B. anthracis strain differences (with/without plasmids)

    • Consider growth conditions and phase (vegetative vs. sporulation)

    • Examine host cell types if host-pathogen interactions were studied

  • Analytical Approach:

    • Perform meta-analysis when multiple studies exist

    • Design experiments specifically to test competing hypotheses

    • Consider whether both results might be correct under different conditions

A systematic approach to reconciling differences often leads to deeper understanding of protein behavior in different contexts.

What statistical approaches are most appropriate for analyzing BAMEG_1207 functional data?

Statistical analysis should be tailored to the experimental design:

Experiment TypeRecommended Statistical ApproachConsiderations
Comparison of expression levelst-test (two conditions) or ANOVA (multiple conditions)Check for normality; consider non-parametric alternatives if needed
Dose-response relationshipsRegression analysisDetermine appropriate model (linear, exponential, sigmoidal)
Survival/persistence studiesKaplan-Meier analysis with log-rank testAccount for censored data
Proteomics dataFalse Discovery Rate correction for multiple comparisonsControl for protein abundance biases
Structure-function relationshipsMultiple testing correction for correlation analysesConsider structural constraints in the model

Report both statistical significance (p-values) and effect sizes to provide complete information about the biological relevance of findings.

What are the most promising research directions for BAMEG_1207?

Based on current knowledge of B. anthracis biology, promising research directions include:

  • Structural characterization to identify potential binding pockets or catalytic sites

  • Comparative analysis with homologs in other Bacillus species to understand evolutionary conservation

  • Investigation of expression patterns during infection versus environmental persistence

  • Exploration of potential contributions to antibiotic resistance or stress responses

  • Assessment of vaccine potential if surface-exposed or immunogenic

Each direction can provide valuable insights into both basic biology and potential applications.

How might findings about BAMEG_1207 contribute to broader understanding of B. anthracis pathogenicity?

Research on BAMEG_1207 has potential implications for:

  • Pathogenesis mechanisms - particularly if it interacts with known virulence factors

  • Environmental persistence - potentially explaining how B. anthracis survives outside hosts

  • Host-pathogen interactions - if involved in immune evasion or host resource acquisition

  • Evolution of virulence - through comparative analysis with non-pathogenic relatives

  • Therapeutic targets - identifying new vulnerability points for antimicrobial development

B. anthracis remains a significant biodefense concern, and understanding all aspects of its biology, including the role of uncharacterized proteins like BAMEG_1207, contributes to preparedness efforts .

What interdisciplinary approaches might accelerate understanding of BAMEG_1207?

Advancing knowledge about BAMEG_1207 would benefit from:

  • Structural biology and biophysics for detailed molecular characterization

  • Systems biology to place BAMEG_1207 in broader cellular networks

  • Immunology to assess host responses if involved in pathogenesis

  • Evolutionary biology to understand conservation across the B. cereus group

  • Computational biology for prediction of function and interactions

  • Synthetic biology to engineer variants for functional testing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.