Recombinant Bacillus anthracis UPF0344 protein BAA_1237 (BAA_1237)

What is the basic structural composition of BAA_1237 protein?

The BAA_1237 protein is a UPF0344 family protein from Bacillus anthracis (strain A0248) with UniProt accession number C3P3K4. It consists of 121 amino acids with the sequence: MVHMHITAWALGLILFFVAYSLYSGRKGKGVHMGLRLMYIIIIVTGFMLYMGIMKTATSNMHMWYGLKMIAGILVIGGMEMVLVKMSKNKATGAVWGLFIVALVAVFYLGLKLPIGWQVF . This protein likely has transmembrane domains based on its hydrophobic amino acid content, suggesting it may function as a membrane-associated protein.

What cellular functions has the UPF0344 protein family been associated with?

The UPF0344 protein family, including BAA_1237, belongs to uncharacterized protein families (UPF) where the precise biological function remains to be fully elucidated. Structural analysis suggests these proteins may play roles in membrane processes, potentially involved in transport or signaling pathways in Bacillus anthracis. The membrane-spanning regions evident in the amino acid sequence indicate integration into cellular membranes, possibly contributing to bacterial membrane integrity or function .

What are the optimal expression and purification strategies for BAA_1237 protein?

For optimal expression of BAA_1237, researchers should consider:

Expression System:

• E. coli BL21 Star (DE3) cells are recommended for recombinant expression

• Use pET21b expression vectors with C-terminal 6xHis-tag for purification

• For isotope labeling, MJ9 minimal media can be used for 15N-labeled proteins

Purification Protocol:

• Harvest cells by centrifugation (6,000g, 10 minutes, 4°C)

• Resuspend in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole)

• Lyse using sonication or pressure homogenization

• Clarify lysate by centrifugation (20,000g, 30 minutes, 4°C)

• Purify using Ni-NTA affinity chromatography

• Further purify by size exclusion chromatography if higher purity is required

• Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage

What NMR-based approaches can be used to study BAA_1237 structure?

NMR spectroscopy offers powerful tools for studying protein structure and dynamics. For BAA_1237, consider:

Sample Preparation:

• Prepare 15N-labeled protein at concentrations of ~200-400 μM for standard measurements

• Use 5mm Shigemi tubes for sensitivity-limited experiments

• Buffer conditions: 20 mM sodium phosphate, pH 6.0-7.0, 50-150 mM NaCl

NMR Experiments:

• 2D 1H-15N HSQC for backbone assignment

• 1H-13C Constant-Time HSQC for aliphatic and aromatic signals

• 3D HNCO, HN(CO)CACB, and HNCACB for complete backbone assignment

• BEST pulse sequence can be applied to triple resonance measurements

Equipment:

• High-field NMR (600-950 MHz) with cryogenic probes (QCI cryo-Probe)

• Temperature control at 303K (30°C)

How can computational modeling be integrated with experimental data for BAA_1237 structural determination?

Computational modeling provides valuable insights when integrated with experimental data:

Computational Approaches:

• Homology Modeling: Use structurally characterized UPF0344 family proteins (such as those from Staphylococcus aureus) as templates

• Ab initio Modeling: For regions with no homology, employ tools like AlphaFold or Rosetta

• Molecular Dynamics Simulations: Refine models and assess stability in membrane environments

Integration with Experimental Data:

• Validate computational models against NMR chemical shift data

• Use residual dipolar couplings (RDCs) to refine orientation of structural elements

• Compare predicted and experimental secondary structure elements

Assessment Metrics:

What are the challenges in studying potential interactions between BAA_1237 and host proteins during infection?

Investigating BAA_1237-host interactions presents several challenges:

Technical Challenges:

• Membrane protein solubility issues require specialized approaches

• Low-abundance interactions may be difficult to detect

• Potential transient interactions could be missed by conventional methods

Methodological Solutions:

• Cross-linking Mass Spectrometry (XL-MS): Use membrane-permeable crosslinkers to capture transient interactions

• Proximity-based Labeling: Employ BioID or APEX2 fusions to identify proteins in close proximity

• Reconstitution Systems: Use nanodiscs or liposomes to preserve native membrane environment

• Split Reporter Assays: Develop split-GFP or split-luciferase systems for in vivo detection

How does BAA_1237 compare structurally with UPF0344 proteins from other bacterial species?

Comparative analysis reveals evolutionary relationships and structural conservation:

Structural Comparison:

• UPF0344 proteins across bacterial species share similar membrane-spanning topologies

• The computed structure model for Staphylococcus aureus UPF0344 protein (AF_AFA6U076F1) shows confidence scores (pLDDT) of 79.76 globally, suggesting moderately reliable structural predictions

• Regions with pLDDT > 90 represent highly conserved structural elements across the protein family

Sequence Conservation Analysis:

• Core transmembrane regions show higher conservation than loop regions

• Key residues in the sequence MVHMHITAWA and GLRLMYIII are often conserved across UPF0344 proteins

• Phylogenetic analysis places BAA_1237 within a distinct clade compared to UPF0344 proteins from other pathogenic bacteria

What functional insights can be gained from phylogenomic analysis of BAA_1237?

Phylogenomic approaches provide context for functional predictions:

Analysis Methodology:

• Identify orthologs using OrthoMCL algorithm with e-value threshold of 10-5

• Generate multiple sequence alignments with MUSCLE

• Filter alignments with RASCAL and GBLOCKS

• Construct phylogenetic trees using maximum-likelihood (RAxML) and maximum-parsimony methods

• Evaluate genetic distances between orthologous genes

Functional Implications:

• Co-evolution with specific gene clusters may indicate functional relationships

• Conserved genomic context can suggest participation in specific pathways

• Comparison with UPF0344 proteins from non-pathogenic bacteria may highlight virulence-related adaptations

What evidence exists for BAA_1237's potential role in Bacillus anthracis virulence?

Understanding BAA_1237's possible contribution to pathogenesis:

Current Evidence:

• Membrane proteins in pathogenic bacteria often contribute to host-pathogen interactions

• The presence in the clinically relevant Bacillus anthracis strain A0248 suggests potential importance

• Membrane localization positions BAA_1237 at the interface of bacterial-host interactions

Research Approaches:

• Gene Deletion Studies: Assess changes in virulence in animal models

• Transcriptomics: Analyze expression patterns during infection stages

• Immunological Studies: Test if BAA_1237 elicits immune responses in hosts

• Localization Studies: Determine subcellular distribution during infection

How might BAA_1237 be targeted for therapeutic development against anthrax?

Exploring BAA_1237 as a potential therapeutic target:

Target Assessment:

• Membrane accessibility makes BAA_1237 potentially targetable by antibodies or small molecules

• Conservation across Bacillus anthracis strains would suggest broader therapeutic potential

• Structural uniqueness compared to human proteins would minimize off-target effects

Therapeutic Strategies:

• Antibody Development: Generate antibodies against exposed epitopes

• Peptide Inhibitors: Design peptides that disrupt protein-protein interactions

• Small Molecule Screening: Identify compounds that bind and inhibit function

• Vaccine Component: Evaluate as a potential component in next-generation anthrax vaccines

What strategies can address protein aggregation issues when working with recombinant BAA_1237?

Membrane proteins like BAA_1237 often present aggregation challenges:

Prevention Strategies:

• Expression Optimization:

  • Lower induction temperature (16-18°C)

  • Use weaker promoters or lower inducer concentrations

  • Consider specialized E. coli strains (C41, C43) designed for membrane proteins

• Buffer Optimization:

  • Include mild detergents (0.1% DDM, 0.5% CHAPS)

  • Add stabilizing agents (5-10% glycerol, 100-500 mM arginine)

  • Test pH range 6.0-8.0 to find optimal stability

• Purification Approach:

  • Increase salt concentration (300-500 mM NaCl)

  • Include reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol)

  • Use gradient elution to separate aggregates from properly folded protein

How can researchers effectively validate antibodies against BAA_1237 for research applications?

Robust antibody validation ensures reliable experimental results:

Validation Methodology:

• Specificity Testing:

  • Western blot against recombinant protein and bacterial lysates

  • Test knockout/knockdown controls

  • Peptide competition assays with immunizing peptide

• Cross-Reactivity Assessment:

  • Test against related UPF0344 proteins from other bacterial species

  • Evaluate potential cross-reactivity with host proteins

• Application-Specific Validation:

  • For immunofluorescence: compare localization patterns with GFP-tagged constructs

  • For immunoprecipitation: verify enrichment by mass spectrometry

  • For ELISA: establish standard curves with purified protein