Recombinant Bacillus anthracis UPF0756 membrane protein BAA_4851 (BAA_4851)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a preferred tag type, please inform us and we will prioritize its development.
Synonyms
BAA_4851; UPF0756 membrane protein BAA_4851
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Bacillus anthracis (strain A0248)
Target Names
BAA_4851
Target Protein Sequence
MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFLGDKVFPYLQTKGINLGVTVIT IAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTDPHITTALVFG TIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK
Uniprot No.

Target Background

Database Links

KEGG: bai:BAA_4851

Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant BAA_4851 protein?

The optimal storage of recombinant BAA_4851 protein requires careful attention to several parameters to maintain its stability and biological activity. The protein is typically supplied as a lyophilized powder and should be stored at -20°C to -80°C upon receipt . Long-term storage at these temperatures is essential for maintaining protein integrity.

When handling the protein:

  • Brief centrifugation of the vial prior to opening is recommended to bring the contents to the bottom of the tube

  • For reconstitution, deionized sterile water should be used to achieve a concentration of 0.1-1.0 mg/mL

  • The addition of 5-50% glycerol (final concentration) is strongly recommended as a cryoprotectant when preparing aliquots for long-term storage

  • The default final concentration of glycerol recommended by suppliers is 50%

For working solutions, aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they can significantly compromise protein integrity . If multiple experiments are planned, it is advisable to prepare single-use aliquots immediately after reconstitution.

How should BAA_4851 protein be reconstituted for experimental use?

Proper reconstitution of lyophilized BAA_4851 is critical for downstream applications. The recommended protocol involves:

  • Centrifuge the vial briefly before opening to ensure all material is at the bottom

  • Reconstitute the protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL

  • Gently mix by inversion or mild vortexing until completely dissolved

  • For long-term storage, add glycerol to a final concentration of 5-50% (preferably 50%)

  • Aliquot the reconstituted protein into single-use volumes to prevent freeze-thaw damage

The reconstituted protein will be in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain protein stability . When planning experiments, it's important to consider this buffer composition, as it may influence certain assays or applications. If buffer exchange is necessary, methods such as dialysis or size exclusion chromatography should be performed at 4°C to minimize protein degradation.

What experimental approaches are most effective for studying the membrane topology of BAA_4851?

Determining the membrane topology of BAA_4851 requires a multi-technique approach to generate a reliable structural model. Based on its amino acid sequence and predicted hydrophobicity profile, the protein likely contains multiple transmembrane segments. To experimentally validate this, consider the following methodological approaches:

  • Cysteine scanning mutagenesis and accessibility studies:

    • Create a cysteine-less variant of BAA_4851

    • Introduce single cysteine residues at various positions throughout the protein

    • Determine accessibility of these cysteines to membrane-impermeable thiol-reactive reagents

    • This methodology can distinguish between periplasmic, cytoplasmic, and transmembrane regions

  • Proteolytic digestion analysis:

    • Reconstitute purified BAA_4851 into proteoliposomes

    • Perform limited proteolysis with proteases such as trypsin or chymotrypsin

    • Analyze protected fragments using mass spectrometry

    • Regions embedded in the membrane will be protected from proteolytic cleavage

  • Fluorescence spectroscopy:

    • Introduce fluorescent probes at specific residues

    • Measure quenching by lipid-soluble or water-soluble quenchers

    • This approach can determine the depth of specific residues within the membrane

  • Cryo-electron microscopy:

    • For high-resolution structural determination

    • May require optimization of detergent conditions for protein stabilization

    • Consider incorporating the protein into nanodiscs to maintain a native-like lipid environment

When designing these experiments, it's crucial to account for the potential effects of the His-tag on topology. Control experiments with both N-terminal and C-terminal tagged versions, as well as tag-free protein, would provide more reliable results.

How can BAA_4851 be functionally characterized given its uncharacterized (UPF) status?

Functionally characterizing an uncharacterized protein like BAA_4851 requires a systematic approach combining computational predictions with empirical experiments:

  • Computational analysis and predictions:

    • Sequence similarity searches against characterized proteins

    • Structural homology modeling using tools like Phyre2 or I-TASSER

    • Domain prediction and functional site identification

    • Genomic context analysis (examining nearby genes and operons)

  • Protein-protein interaction studies:

    • Pull-down assays using His-tagged BAA_4851 as bait

    • Bacterial two-hybrid screening

    • Cross-linking studies followed by mass spectrometry

    • Co-immunoprecipitation with antibodies against BAA_4851

  • Gene knockout and complementation studies:

    • Generate a BAA_4851 deletion mutant in B. anthracis

    • Assess phenotypic changes in growth, morphology, and virulence

    • Complement with wild-type and mutant versions to confirm specificity

    • Perform comparative transcriptomics of wild-type vs. deletion mutant

  • Biochemical activity screening:

    • Test for common membrane protein functions (transporter, channel, enzyme)

    • Assess ion transport capabilities using fluorescent probes

    • Screen for potential enzymatic activities using substrate libraries

    • Evaluate potential roles in membrane integrity or stress response

Given that B. anthracis contains virulence factors encoded on plasmids pXO1 and pXO2 , investigating potential interactions between BAA_4851 and these virulence systems could provide valuable insights into its biological role.

What are the considerations when using BAA_4851 for structural studies?

Structural studies of membrane proteins like BAA_4851 present unique challenges that require careful experimental design:

  • Protein expression optimization:

    Expression SystemAdvantagesDisadvantages
    E. coliFast growth, high yieldPotential misfolding
    Cell-freeControl over environmentLower yield, expensive
    Insect cellsBetter foldingSlower, complex glycosylation
  • Purification considerations:

    • Initial IMAC purification via His-tag

    • Secondary purification steps (size exclusion, ion exchange)

    • Critical detergent selection based on CMC values and protein stability

    • Detergent screening table for membrane protein purification:

      DetergentCMC (mM)Micelle Size (kDa)Suitability
      DDM0.1770Good initial choice
      LMNG0.01100Enhanced stability
      SDS8.018Denaturing, avoid
      Digitonin0.570Mild, good for complexes
  • Crystallization strategies:

    • Lipidic cubic phase for in meso crystallization

    • Vapor diffusion with detergent-solubilized protein

    • Crystal dehydration techniques to improve diffraction

    • Surface entropy reduction mutants to promote crystal contacts

  • Alternative structural techniques:

    • Cryo-EM: increasingly powerful for membrane proteins

    • NMR: suitable for specific domains or smaller fragments

    • SAXS/SANS: low-resolution envelope determination

    • HDX-MS: conformational dynamics and ligand binding

When designing constructs for structural studies, consider removing flexible termini to enhance crystallization propensity. Creating truncation constructs that retain putative functional domains might also be beneficial. Additionally, incorporating thermostabilizing mutations or fusion proteins (such as T4 lysozyme or BRIL) may improve structural stability.

How might BAA_4851 be involved in Bacillus anthracis pathogenesis?

While direct evidence linking BAA_4851 to pathogenesis is limited in the available literature, several investigative approaches can elucidate its potential role:

  • Expression analysis during infection:

    • qRT-PCR to measure BAA_4851 expression levels during different stages of infection

    • RNA-seq to place BAA_4851 in the context of global transcriptional changes

    • Construct reporter strains (e.g., BAA_4851 promoter driving GFP) to monitor expression during host interaction

  • Virulence assessment of mutant strains:

    • Generate BAA_4851 deletion mutants and assess virulence in appropriate animal models

    • Measure impact on adhesion to host cells using in vitro assays

    • Evaluate effects on sporulation efficiency and spore resistance properties

    • Assess potential changes in antibiotic resistance profiles

  • Interaction with known virulence factors:

    • B. anthracis virulence depends on two key plasmids: pXO1 (encoding protective antigen, lethal factor, and edema factor) and pXO2 (encoding the poly-γ-D-glutamic acid capsule)

    • Investigate potential interactions between BAA_4851 and these virulence factors

    • Examine co-expression patterns during infection

    • Test for physical interactions using pull-down assays

  • Host response studies:

    • Assess immune response to BAA_4851 during infection

    • Investigate potential immunomodulatory properties

    • Evaluate BAA_4851 as a diagnostic marker or vaccine candidate

Since B. anthracis has three distinct disease forms (cutaneous, gastrointestinal, and inhalation anthrax) , the role of BAA_4851 may vary depending on the infection route. Developing tissue-specific infection models could help clarify its function in different disease contexts.

What experimental approaches can determine if BAA_4851 could be a potential therapeutic target?

Evaluating BAA_4851 as a potential therapeutic target requires a comprehensive assessment strategy:

  • Essentiality determination:

    • Conditional gene knockout systems to determine if BAA_4851 is essential for viability

    • CRISPRi or antisense RNA approaches for controlled gene knockdown

    • Transposon mutagenesis coupled with NGS (Tn-seq) to assess gene importance under various conditions

    • Growth curve analysis of deletion mutants in different environmental conditions

  • High-throughput inhibitor screening:

    • Develop functional assays suitable for screening compound libraries

    • Consider the following screening cascade:

      Screen StageApproachThroughputPurpose
      PrimaryBinding assays (thermal shift)HighInitial hit identification
      SecondaryFunctional assaysMediumConfirm biological activity
      TertiaryCell-based assaysLowValidate cellular efficacy
      QuaternaryAnimal modelsVery lowIn vivo validation
  • Structure-based drug design:

    • Identify potential binding pockets using computational tools

    • Virtual screening of compound libraries against these pockets

    • Fragment-based drug discovery approaches

    • Rational design of peptidomimetics targeting critical protein-protein interfaces

  • Differential targeting potential:

    • Comparative analysis with human proteins to identify unique features

    • Assessment of conservation across bacterial species

    • Evaluation of potential off-target effects using proteomics approaches

When evaluating therapeutic potential, it's important to consider that B. anthracis can form spores that are highly resistant to environmental stresses . Therefore, therapeutic strategies targeting BAA_4851 might be most effective against vegetative cells during active infection rather than dormant spores.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.