Recombinant Bacillus anthracis UPF0756 membrane protein BAMEG_4871 (BAMEG_4871)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characterization

BAMEG_4871 is annotated as a member of the UPF0756 family, a group of conserved bacterial proteins with unknown molecular functions. Key features inferred from genomic and proteomic studies include:

  • Domain Architecture:

    • Predicted transmembrane helices (TMDs) typical of integral membrane proteins.

    • Conserved residues in extracellular/cytoplasmic loops, suggesting potential ligand-binding or enzymatic roles .

  • Genomic Context:

    • Located adjacent to virulence-associated loci in B. anthracis plasmids (e.g., near cap genes for capsule synthesis) .

    • Homologs identified in B. cereus biovar anthracis strains, indicating evolutionary conservation among anthrax-causing bacilli .

Recombinant Production and Purification

Recombinant BAMEG_4871 is typically produced in heterologous systems like Escherichia coli. Standard workflows include:

Expression and Solubilization

StepMethod/ReagentOutcome
CloningpET or pQE vectorsGene insertion with His-tag fusion .
Membrane extractionDetergents (DDM, LMNG)Solubilization of membrane proteins .
PurificationNi-NTA chromatographyHigh-purity protein (>90%) .

Key Challenges

  • Stability: Requires lipid environments (e.g., SMALP nanoparticles) to maintain native conformation .

  • Endotoxin Removal: Critical for in vivo applications; achieved via detergent exchange or affinity resins .

Applications in Research and Development

  • Vaccine Antigens:

    • Recombinant B. anthracis proteins (e.g., BclA, PA) are evaluated for immunogenicity in nanoparticle formulations .

    • BAMEG_4871 could serve as a novel antigen if surface-exposed epitopes are confirmed .

  • Diagnostic Targets:

    • Detection of anti-BAMEG_4871 antibodies in sera may improve anthrax diagnostics, complementing existing LRN guidelines .

Knowledge Gaps and Future Directions

  • Functional Validation: Targeted gene knockout studies in B. anthracis to assess impact on virulence or metabolism .

  • Structural Biology: Cryo-EM or X-ray crystallography to resolve 3D architecture .

  • Host-Pathogen Interactions: Screening for mammalian cell receptor binding using surface plasmon resonance (SPR) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
BAMEG_4871; UPF0756 membrane protein BAMEG_4871
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Bacillus anthracis (strain CDC 684 / NRRL 3495)
Target Names
BAMEG_4871
Target Protein Sequence
MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFLGDKVFPYLQTKGINLGVTVIT IAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTDPHITTALVFG TIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus anthracis and why study its membrane proteins?

Bacillus anthracis is the causative agent of anthrax, a rare but potentially fatal infectious disease. The bacteria exist as dormant spores in soil and primarily affect grazing animals, though human infection can occur through three main routes: skin contact (cutaneous), ingestion (gastrointestinal), or inhalation . Studying membrane proteins from this organism is crucial for several reasons:

  • Membrane proteins often play vital roles in bacterial pathogenesis

  • They represent potential targets for antimicrobial development

  • Understanding their structure-function relationships can inform vaccine design

  • Characterization of uncharacterized protein families (UPF) like UPF0756 contributes to fundamental microbiology knowledge

The study of BAMEG_4871 specifically may provide insights into B. anthracis biology that could ultimately contribute to better preventive or therapeutic approaches for anthrax.

What biosafety considerations apply when working with B. anthracis proteins?

B. anthracis is classified as a BSL-3 organism, requiring highly contained conditions not suitable for many experimental procedures . When working with proteins derived from this pathogen, researchers must consider:

  • Recombinant expression in surrogate systems rather than native isolation

  • Use of non-pathogenic surrogates for preliminary studies

  • Risk assessment for potential biological threat concerns

  • Institutional biosafety committee approvals

Even when working with a single recombinant protein like BAMEG_4871, researchers should be aware that B. anthracis pathogenicity is attributed to secreted exotoxins and the protective outer capsule . While the membrane protein itself may not possess direct virulence properties, institutional policies for work with select agent-derived materials should be followed.

What expression systems are recommended for recombinant BAMEG_4871?

Based on experience with other B. anthracis proteins, several expression systems may be appropriate:

Expression SystemAdvantagesDisadvantagesBest For
E. coliHigh yield, economical, rapidMay not properly fold membrane proteinsInitial structural studies, antibody production
B. subtilisClosely related to B. anthracis, better membrane protein foldingLower yields than E. coliFunctional studies requiring proper folding
Mammalian cellsPost-translational modifications, membrane integrationExpensive, time-consumingInteraction studies with host factors
Cell-free systemsAvoids toxicity issues, direct membrane incorporationTechnically challenging, expensiveDifficult-to-express proteins

When expressing membrane proteins from B. anthracis, solubility can be a significant challenge. For example, in studies with protective antigen (PA) constructs, researchers found that full-length PA was more difficult to express as a soluble protein compared to truncated versions . Similar challenges may apply to BAMEG_4871, suggesting that optimization of expression conditions or use of solubility tags may be necessary.

How can I verify proper expression and folding of recombinant BAMEG_4871?

Verification of proper expression and folding for membrane proteins requires multiple approaches:

  • Western blotting: Confirms expression at expected molecular weight

  • Circular dichroism (CD) spectroscopy: Assesses secondary structure elements

  • Fluorescence spectroscopy: Evaluates tertiary structure when tryptophan residues are present

  • Detergent solubility screening: Tests extraction efficiency from membranes

  • Size exclusion chromatography: Confirms monodispersity and absence of aggregation

For membrane proteins like BAMEG_4871, additional tests may include:

  • Reconstitution into liposomes or nanodiscs to verify membrane integration

  • Limited proteolysis to assess structural integrity

  • Thermal stability assays to evaluate structural robustness

What surrogate organisms are recommended for studying B. anthracis membrane proteins?

  • Genetic similarity to B. anthracis

  • Similar cell membrane composition and structure

  • Comparable protein expression machinery

  • Low risk of pathogenicity

Studies have shown that while B. atrophaeus has been widely used as a B. anthracis surrogate, the two species do not always behave identically in transport and survival models . Therefore, when studying membrane proteins like BAMEG_4871, B. thuringiensis may provide more translatable results.

The use of attenuated B. anthracis strains might seem ideal, but concerns remain about plasmid exchange rates and environmental effects of these strains. Additionally, even attenuated strains could create public relations issues or mask actual threats if released .

How can I design experiments to elucidate the function of BAMEG_4871?

Elucidating the function of an uncharacterized membrane protein requires a multi-faceted approach:

  • Bioinformatic analysis:

    • Sequence homology with characterized proteins

    • Structural prediction using AI tools like AlphaFold2

    • Identification of conserved domains or motifs

    • Genomic context analysis (neighboring genes often functionally related)

  • Gene knockout or knockdown studies:

    • Create deletion mutants in surrogate organisms

    • Analyze phenotypic changes under various conditions

    • Complement with wild-type and mutated versions of the protein

  • Localization studies:

    • GFP fusion proteins to determine subcellular localization

    • Immunogold electron microscopy for precise membrane localization

    • Fractionation studies to confirm membrane association

  • Interaction studies:

    • Pull-down assays to identify binding partners

    • Bacterial two-hybrid systems

    • Cross-linking mass spectrometry

  • Functional assays:

    • Membrane permeability tests

    • Transport assays if suspected to be a transporter

    • Enzymatic activity screens

Researchers should note that while we know B. anthracis pathogenicity involves secreted exotoxins including protective antigen (PA), which serves as the host cell-binding component , the specific role of BAMEG_4871 would require dedicated experimental investigation using these approaches.

What structural characterization methods are most appropriate for BAMEG_4871?

Membrane proteins present unique challenges for structural characterization. For BAMEG_4871, consider these approaches:

MethodResolutionSample RequirementsAdvantagesLimitations
X-ray crystallographyAtomicMilligram quantities of pure, crystallizable proteinHigh resolution, detailed structural informationDifficult to crystallize membrane proteins
Cryo-EMNear-atomicMicrogram quantities, structurally homogeneousWorks with smaller samples, captures different conformational statesLower resolution for smaller proteins
NMR spectroscopyAtomicIsotopically labeled protein, typically <30 kDaDynamic information, solution stateSize limitations, large amounts of sample
SAXS/SANSLowPurified protein in solutionLow sample requirements, solution stateLow resolution, shape information only
Computational predictionVariesSequence dataRapidly improving accuracy with AI methodsPredictions require experimental validation

Recent advances in AI-based protein structure prediction, such as AlphaFold2, have dramatically improved the accuracy of computational structure determination . For uncharacterized proteins like BAMEG_4871, these methods provide valuable starting points for experimental design, especially when experimental structural determination is challenging.

How can post-translational modifications of BAMEG_4871 be identified and characterized?

Post-translational modifications (PTMs) can significantly impact protein function. For BAMEG_4871, consider:

  • Mass spectrometry-based approaches:

    • Bottom-up proteomics: Protein digestion followed by LC-MS/MS

    • Top-down proteomics: Analysis of intact protein

    • Targeted MS methods for specific modification types

  • Site-directed mutagenesis:

    • Mutation of putative modification sites

    • Functional comparison between wild-type and mutant proteins

  • Modification-specific detection methods:

    • Phosphorylation: Phospho-specific antibodies, Pro-Q Diamond staining

    • Glycosylation: Lectin-based detection, PAS staining

    • Lipidation: Click chemistry with lipid analogs

  • Prediction tools:

    • NetPhos for phosphorylation

    • NetNGlyc/NetOGlyc for glycosylation

    • GPS-Lipid for lipidation

When working with recombinant expression systems, researchers should be aware that PTMs present in the native B. anthracis context may not be replicated in heterologous systems, potentially affecting protein function and interaction studies.

How can I troubleshoot poor expression yields of BAMEG_4871?

Poor expression of membrane proteins is common but can be addressed through systematic optimization:

  • Expression system optimization:

    • Test multiple host strains (BL21(DE3), C41/C43, SHuffle)

    • Evaluate different promoter systems (T7, tac, araBAD)

    • Consider specialized membrane protein expression strains

  • Expression conditions:

    • Lower induction temperature (16-20°C)

    • Reduce inducer concentration

    • Extend expression time

    • Test auto-induction media

  • Construct optimization:

    • Remove predicted disordered regions

    • Try fusion partners (MBP, SUMO, Mistic)

    • Test truncated constructs focusing on specific domains

  • Co-expression strategies:

    • Chaperones (GroEL/ES, DnaK/J)

    • Protein disulfide isomerases if disulfide bonds are present

    • Partner proteins if known

Based on experiences with other B. anthracis proteins, researchers might consider creating domain constructs similar to the approach used with protective antigen, where PA was expressed as full-length (PA-FL), C-terminal fragment (PA63), and domain chimeras (PA-D1-4, PA-D4) .

What analytical techniques are most informative for characterizing membrane protein function?

Functional characterization of membrane proteins requires specialized techniques:

  • Electrophysiology:

    • Patch clamp for ion channel activity

    • Planar bilayer recordings

    • Solid-supported membrane electrophysiology

  • Transport assays:

    • Radioactive substrate uptake

    • Fluorescent substrate transport

    • Liposome-based transport assays

  • Binding studies:

    • Surface plasmon resonance (SPR)

    • Microscale thermophoresis (MST)

    • Isothermal titration calorimetry (ITC)

  • Structural dynamics:

    • Hydrogen-deuterium exchange mass spectrometry

    • Electron paramagnetic resonance spectroscopy

    • FRET-based conformational studies

For BAMEG_4871, the specific analytical techniques employed would depend on hypothesized functions based on bioinformatic analyses and initial characterization results.

How can I design experiments to determine if BAMEG_4871 contributes to virulence?

Even though BAMEG_4871 is not among the well-characterized virulence factors of B. anthracis (which include protective antigen and other toxin components) , investigating its potential contribution to virulence requires careful experimental design:

  • Genetic approaches:

    • Create deletion mutants in surrogate organisms

    • Complementation studies

    • Expression level modulation and impact assessment

  • Interaction studies with host factors:

    • Pull-down assays with host cell lysates

    • Yeast two-hybrid screening against human protein libraries

    • Co-immunoprecipitation studies

  • Cellular models:

    • Infection assays with wild-type vs. mutant bacteria

    • Transfection of BAMEG_4871 into host cells

    • Measurement of cytokine responses or cellular damage

  • Animal model studies (using appropriate surrogates):

    • Virulence comparison between wild-type and mutant strains

    • In vivo imaging to track infection progression

    • Immune response characterization

When designing these experiments, researchers should consider using B. thuringiensis as a surrogate organism, as it has been identified as the best non-pathogenic surrogate for B. anthracis .

How should I interpret contradictory results in BAMEG_4871 localization studies?

Contradictory localization results are common in membrane protein research and require systematic troubleshooting:

  • Evaluate tagging effects:

    • Compare N-terminal vs. C-terminal tags

    • Use smaller tags (myc, FLAG vs. GFP)

    • Verify functionality of tagged protein

  • Consider expression level artifacts:

    • Overexpression can lead to mislocalization

    • Use native promoters where possible

    • Validate with antibodies against the native protein

  • Assess extraction methods:

    • Different detergents may preferentially extract from different membrane domains

    • Compare gentle vs. harsh extraction methods

    • Use multiple fractionation approaches

  • Cross-validate with multiple methods:

    • Fluorescence microscopy

    • Subcellular fractionation

    • Protease accessibility

    • Immunoelectron microscopy

When reporting results, transparently discuss methodological differences that might account for contradictions and design definitive experiments to resolve discrepancies.

How can computational tools help predict the function of BAMEG_4871?

Computational approaches provide valuable insights for uncharacterized proteins:

  • Sequence-based analysis:

    • BLAST for homology identification

    • Multiple sequence alignment for conserved residues

    • Motif recognition (PROSITE, PFAM)

    • Transmembrane topology prediction (TMHMM, Phobius)

  • Structure-based analysis:

    • Structure prediction using AlphaFold2 or RoseTTAFold

    • Structural comparison with characterized proteins

    • Binding pocket identification

    • Molecular dynamics simulations

  • Genomic context analysis:

    • Operonic arrangement

    • Gene neighborhood conservation

    • Co-expression patterns

    • Phylogenetic profiling

  • Network-based approaches:

    • Protein-protein interaction prediction

    • Metabolic pathway association

    • Co-evolution analysis

The continuous improvement of AI-based protein structure prediction tools has revolutionized the study of uncharacterized proteins. These technologies can now predict the three-dimensional structure of unknown proteins with remarkable accuracy, accelerating drug discovery and biological research .

What statistical approaches are appropriate for analyzing membrane protein interaction data?

Analyzing interaction data for membrane proteins requires specialized statistical considerations:

  • Control for membrane effects:

    • Use appropriate membrane mimetics as controls

    • Apply background subtraction algorithms specific to membrane contexts

    • Consider detergent/lipid interference with signal

  • Account for multivalent interactions:

    • Apply cooperative binding models

    • Use cluster analysis for identifying interaction patterns

    • Implement network analysis for complex interaction landscapes

  • Appropriate statistical tests:

    • Multiple testing correction for large-scale screens

    • Reproducibility metrics across replicates

    • Significance thresholds adjusted for membrane protein contexts

  • Visualization approaches:

    • Heat maps for interaction networks

    • Principal component analysis for multivariate data

    • Volcano plots for simultaneously assessing significance and effect size

When interpreting interaction studies, consider both statistical significance and biological relevance, particularly in the context of membrane-associated proteins where interaction dynamics may differ from soluble proteins.

How might understanding BAMEG_4871 contribute to anthrax vaccine development?

While protective antigen (PA) is the primary component in current anthrax vaccines , membrane proteins like BAMEG_4871 could potentially contribute to next-generation vaccine approaches:

  • Multivalent vaccine strategies:

    • Combination of PA with other antigenic components

    • Broader protection against different strains

    • Potentially enhanced immune response

  • Delivery system development:

    • Membrane proteins as components of outer membrane vesicles

    • Liposomal delivery systems incorporating membrane antigens

    • Nanoparticle-based antigen presentation

  • Conserved epitope identification:

    • Cross-species protection potential

    • T-cell epitope mapping

    • B-cell epitope prediction and validation

Research on protective antigen has shown that various recombinant constructs including full-length PA (PA-FL), C-terminal fragments (PA63), and domain chimeras (PA-D1-4, PA-D4) can be effective vaccine candidates when combined with appropriate adjuvants like Addavax, Alhydrogel, and Montanide ISA 720 .

What are the challenges in studying protein-protein interactions involving BAMEG_4871?

Membrane protein interaction studies present unique challenges:

  • Solubilization while maintaining interactions:

    • Detergent effects on interaction interfaces

    • Native nanodiscs or amphipol approaches

    • Membrane-mimetic environments

  • Distinguishing specific from non-specific interactions:

    • High background in hydrophobic environments

    • Appropriate negative controls

    • Competition assays for validation

  • Quantification challenges:

    • Membrane protein concentration determination

    • Standard curve development in membrane environments

    • Accounting for detergent/lipid contributions to signals

  • Reconstitution for functional validation:

    • Co-reconstitution of interaction partners

    • Functional assays in reconstituted systems

    • Stoichiometry control and verification

Advanced techniques like hydrogen-deuterium exchange mass spectrometry, chemical cross-linking coupled with mass spectrometry, and single-molecule studies may provide insights into membrane protein interactions that are difficult to capture with traditional approaches.

How can I design experiments to study BAMEG_4871 in the context of B. anthracis spore formation and germination?

Studying membrane proteins in relation to sporulation requires specialized approaches:

  • Temporal expression analysis:

    • Time-course studies during sporulation and germination

    • Stage-specific expression patterns

    • Comparison between vegetative and sporulating cells

  • Localization during sporulation:

    • Fluorescence microscopy throughout sporulation stages

    • Immunoelectron microscopy of developing spores

    • Fractionation of mother cell vs. forespore compartments

  • Genetic manipulation approaches:

    • Stage-specific knockouts/knockdowns

    • Conditional expression systems

    • CRISPR interference for temporal control

  • Biochemical approaches:

    • Pull-down assays at different sporulation stages

    • Crosslinking studies in intact cells

    • Comparative proteomics of wild-type vs. mutant strains

When designing these experiments, researchers should consider that B. anthracis cannot be experimentally released into the environment and requires secure containment . Therefore, using appropriate surrogate organisms like B. thuringiensis would be necessary for many of these studies.

What are the most promising future directions for BAMEG_4871 research?

Research on uncharacterized membrane proteins like BAMEG_4871 has several promising directions:

  • Integration with systems biology:

    • Multi-omics approaches (genomics, transcriptomics, proteomics, metabolomics)

    • Network analysis in the context of bacterial physiology

    • Machine learning applications for function prediction

  • Therapeutic target assessment:

    • Druggability evaluation

    • Virtual screening campaigns

    • Fragment-based drug discovery approaches

  • Structural biology advancements:

    • Cryo-EM technology improvements for membrane proteins

    • Integration of AI-predicted and experimental structures

    • Dynamic structural studies in native-like environments

  • Synthetic biology applications:

    • Engineering based on newly discovered functions

    • Biosensor development

    • Chassis optimization for biotechnology

The field of full-length protein research continues to advance with improved accuracy of protein structure prediction, better understanding of multi-domain proteins and complexes, and innovative applications in protein design . These advances will likely accelerate our understanding of uncharacterized proteins like BAMEG_4871 in the coming years.

How can collaborative approaches accelerate BAMEG_4871 characterization?

Interdisciplinary collaboration is essential for comprehensive protein characterization:

  • Multi-institutional consortia benefits:

    • Access to specialized equipment and expertise

    • Standardized protocols for comparative analyses

    • Broader biological context through diverse perspectives

  • Data sharing frameworks:

    • Pre-publication data repositories

    • Standardized data formats for integration

    • Machine-readable experimental protocols

  • Cross-disciplinary approaches:

    • Combining structural biology with systems biology

    • Integrating computational and experimental methods

    • Applying physical techniques to biological questions

  • Translational research connections:

    • Bridging basic science with potential applications

    • Engaging clinicians in relevant infectious disease research

    • Connecting with biodefense research networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.