Recombinant Bacillus cereus Antiholin-like protein LrgA (lrgA)

Shipped with Ice Packs

In Stock

Cat. No.

BT2059776

Source

in vitro E.coli expression system

Synonyms

lrgA; BC_5439; Antiholin-like protein LrgA

Quick Inquiry

Description

Role in Cell Lysis and Sporulation

Regulation by CdsR: The transcriptional regulator CdsR directly represses lrgAB expression in Bacillus cereus HD73. Deletion of cdsR leads to lrgAB overexpression, triggering cell lysis and halting sporulation .
Holin-Antiholin Dynamics: While LrgA was initially thought to inhibit holin activity (antiholin-like), co-expression of lrgA and lrgB in Bacillus induces membrane pore formation and autolysis, akin to holin-endolysin systems . Overexpression of lrgAB increases cell death rates to 50.63% (±9.31%) compared to 16.93% (±4.63%) in wild-type strains .

Biofilm Formation

Extracellular DNA Release: In Bacillus cereus 0-9, lrgAB upregulation in ΔgapB mutants correlates with increased extracellular DNA (eDNA) release, a critical component of biofilm matrices. This suggests LrgA modulates biofilm integrity via eDNA regulation .

Comparative Analysis with Homologs

Feature	Bacillus cereus LrgA	Staphylococcus aureus LrgA
Primary Role	Dual holin-antiholin function	Antiholin inhibiting murein hydrolases
Operon Partners	lrgB	lrgB
Regulatory Mechanism	Repressed by ArsR-family CdsR	Regulated by LytSR two-component system
Cell Death Link	Induces lysis during sporulation	Inhibits penicillin-induced killing

Applications and Research Implications

Sporulation Studies: Recombinant LrgA is used to investigate sporulation-associated cell lysis, particularly in Bacillus species .
Biofilm Engineering: Its role in eDNA release makes it a target for biofilm disruption strategies in industrial and medical settings .
Phage-Host Interaction Models: The holin-antiholin duality provides insights into bacteriophage lysis mechanisms and bacterial survival tactics .

Key Research Findings

Overexpression Phenotypes:
- lrgAB overexpression in Bacillus cereus HD73 reduces cell density by 60–70% and increases autolysis rates 3-fold .
- Polar septum formation—a sporulation checkpoint—is absent in lrgAB-overexpressing strains .
Transcriptional Dynamics:
- RNA-Seq data show lrgA transcripts increase 30- to 100-fold in ΔcdsR mutants compared to wild-type .
- β-galactosidase assays confirm CdsR-mediated repression of lrgAB promoters .
Structural Insights:
- LrgA contains transmembrane domains characteristic of holin-family proteins, supporting its role in membrane disruption .

Product Specs

Form

Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.

Lead Time

Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments default to normal blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Reconstitution

We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.

Shelf Life

Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.

Synonyms

lrgA; BC_5439; Antiholin-like protein LrgA

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-146

Protein Length

full length protein

Species

Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)

Target Names

lrgA

Target Protein Sequence

MAKMSTKKVYSFLLQAFIFSAIMLISNIIATHLPIPMPSSVIGLVILFSLLCLKVIKLEQ VESLGTALTGIIGFLFVPSGISVINSLGVMGQYFVQILTVIVVATVILLAVTGLFAQFIL GKDEKETEDIKELKVVNKGRKHGKVA

Uniprot No.

Q814J2

Target Background

Function

Recombinant Bacillus cereus Antiholin-like protein LrgA (lrgA) inhibits the expression or activity of extracellular murein hydrolases by interacting, potentially with LrgB, with the holin-like protein CidA. The LrgAB and CidA proteins may influence the proton motive force of the membrane. LrgA may be involved in programmed cell death (PCD), potentially triggering PCD in response to antibiotics and environmental stresses.

Database Links

KEGG: bce:BC5439

STRING: 226900.BC5439

Protein Families

CidA/LrgA family, LrgA subfamily

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Bacillus cereus Antiholin-like protein LrgA (lrgA)

Description

Role in Cell Lysis and Sporulation

Biofilm Formation

Comparative Analysis with Homologs

Applications and Research Implications

Key Research Findings

Product Specs

Target Background

Quick Inquiry

Category

Service