Recombinant Bacillus cereus Antiholin-like protein LrgB (lrgB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Methods

Recombinant LrgB is typically expressed in E. coli or yeast systems. Commercial variants feature His tags for purification and are optimized for stability in Tris-based buffers with glycerol .

Recombinant Variants

SourceExpression HostTagPurityApplications
Creative BioMart E. coliHis tag>85%ELISA, functional studies
MyBioSource E. coliHis tag>90%Diagnostic assays
Cusabio YeastVariable>85%Structural studies

Role in Cell Lysis and Sporulation

  • Holin-Antiholin Dynamics: LrgB partners with LrgA to form the LrgAB complex. Overexpression of lrgAB in B. cereus induces cell lysis by disrupting membrane potential, similar to phage holins .

  • Regulation by CdsR: The transcriptional repressor CdsR inhibits lrgAB expression. Deletion of cdsR leads to uncontrolled lrgAB activation, causing premature cell lysis and sporulation defects .

Biofilm Formation

  • Link to GapB: In B. cereus strain 0-9, GapB (a glyceraldehyde-3-phosphate dehydrogenase) regulates biofilm formation by modulating lrgAB expression. ΔgapB mutants show 6.17-fold upregulated lrgAB transcription, increasing extracellular DNA release and altering biofilm architecture .

Applications in Research

  • Pathogen Detection: Phage-derived proteins targeting B. cereus, including LrgB, are used in gold nanoparticle-based lateral flow assays for rapid diagnostics .

  • Autolysis Studies: Recombinant LrgB aids in dissecting holin-antiholin interactions in Gram-positive bacteria .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lrgB; BCAH187_A5619; Antiholin-like protein LrgB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Bacillus cereus (strain AH187)
Target Names
lrgB
Target Protein Sequence
MASTMTPYFGIVVSLIAYGIGTLLFKHSKGFFLFTPLFVAMVLGIVFLKVGNFTFEEYNT GGKMISFFLEPATIAFAIPLYKQVDKLKKYWWQILSAIVVGSICSVIVVFIVAKAIGLDT AVMNSMLPQAATTAIALPISESIGGIPAITSFAVIFNAVIVYALGALFLKTFRVKHPIAK GLALGTAGHALGVAVGIEMGEVEAAMASIAVTVVGVVTVVVIPMFMPFIG
Uniprot No.

Target Background

Function
LrgB, a recombinant Bacillus cereus Antiholin-like protein, inhibits the expression or activity of extracellular murein hydrolases by interacting, potentially with LrgA, with the holin-like protein CidA. The LrgAB and CidA proteins may influence the proton motive force of the membrane. LrgB might be involved in programmed cell death (PCD), potentially triggering PCD in response to antibiotics and environmental stresses.
Database Links
Protein Families
CidB/LrgB family, LrgB subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Bacillus cereus antiholin-like protein LrgB and what cellular functions does it regulate?

LrgB is an antiholin-like protein in Bacillus cereus that plays a critical role in regulating biofilm formation through mechanisms related to extracellular DNA (eDNA) release. As an antiholin protein, LrgB likely controls cell membrane permeability and programmed cell death processes that contribute to biofilm development. Research has demonstrated that LrgB works in conjunction with LrgA (typically expressed together as LrgAB) to regulate the release of intracellular components, particularly DNA, into the extracellular matrix during biofilm formation .

The LrgAB system functions as a regulatory component that helps maintain proper cellular viability within biofilm communities by controlling the rate of cell lysis. When cells expressing LrgAB proteins are disrupted through genetic manipulation, such as in ΔlrgAB mutant strains, abnormal increases in biofilm formation are observed, suggesting that the LrgAB system typically acts to moderate biofilm development under normal conditions .

How does LrgB differ structurally and functionally from other antiholin proteins found in Gram-positive bacteria?

The LrgB protein in Bacillus cereus exhibits structural characteristics typical of antiholin proteins but with specific adaptations for its function in this particular species. While detailed structural data wasn't provided in the search results, research on related antiholin proteins suggests that LrgB contains multiple transmembrane domains that anchor it within the cell membrane.

Functionally, B. cereus LrgB appears to have specialized roles in biofilm formation that may differ from antiholin proteins in other Gram-positive bacteria. Specifically, experimental evidence shows that LrgB in B. cereus is directly involved in the regulation of extracellular DNA release, which serves as a critical structural component in biofilm matrices . This function appears to be under the regulatory control of GapB, a glyceraldehyde-3-phosphate dehydrogenase, suggesting an intriguing connection between metabolic processes and biofilm formation that may be unique to B. cereus or closely related species.

What experimental evidence demonstrates LrgB's specific role in Bacillus cereus biofilm formation?

Deletion studies provide the most compelling evidence for LrgB's role in B. cereus biofilm formation. When researchers created deletion mutants affecting the lrgAB operon, they observed significant phenotypic changes in biofilm development. Specifically:

  • The ΔlrgAB mutant strain demonstrated substantially increased biofilm production compared to wild-type strains when grown in LBS medium .

  • In dual deletion studies, the ΔgapBΔlrgAB mutant showed partial recovery of biofilm formation ability compared to the ΔgapB mutant alone, suggesting that LrgAB functions downstream of GapB in the biofilm regulation pathway .

  • Fluorescence microscopy analysis revealed differences in the proportion of dead versus living cells within biofilms formed by different mutant strains, with quantitative assessment showing that "the number of living cells in the biofilm formed by the ΔgapB strain was nearly 7.5 times than that of wild-type B. cereus 0-9" .

How does the interaction between GapB and LrgB regulate extracellular DNA release in biofilm development?

The regulatory relationship between GapB and LrgB represents a sophisticated control mechanism for biofilm formation in B. cereus. Transcriptome analysis revealed that deletion of the gapB gene resulted in significant upregulation of lrgAB expression (6.17-fold increase), identifying LrgAB as the most dramatically affected system following GapB loss .

The experimental data supports a model where GapB acts as an upstream regulator of LrgAB expression or activity. When GapB is present (wild-type condition), it appears to maintain appropriate levels of LrgAB, which in turn controls the rate of programmed cell death and subsequent DNA release into the biofilm matrix. When GapB is deleted (ΔgapB mutant), LrgAB expression increases, potentially disrupting the normal balance of cell death and DNA release .

This regulatory pathway appears independent of exopolysaccharide production and the typical SinI/R regulatory system, suggesting a novel mechanism specifically tied to extracellular DNA management. The observation that "GapB is involved in extracellular DNA release and biofilm formation dependent on regulating the expression or activities of LrgAB" points to a specialized regulatory circuit that connects metabolic functions (via GapB) to biofilm development processes (via LrgAB) .

What are the recommended protocols for recombinant expression and purification of Bacillus cereus LrgB protein?

While the search results don't provide a specific protocol for LrgB recombinant expression, we can formulate a methodological approach based on standard recombinant protein techniques and the specific information available:

Expression System Selection:

  • E. coli expression systems utilizing vectors like pET or pAD123 (mentioned in the search results) are suitable for LrgB expression

  • For membrane proteins like LrgB, consider specialized strains optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

Cloning Strategy:

  • Amplify the lrgB gene from B. cereus genomic DNA using PCR with high-fidelity polymerase

  • Include appropriate restriction sites for directional cloning into the expression vector

  • Consider adding a purification tag (His6, GST, or MBP) to facilitate downstream purification

Expression Conditions:

  • Transform expression plasmid into appropriate E. coli strain

  • Grow cultures in standard LB medium at 37°C until mid-log phase

  • Induce protein expression with IPTG (0.1-1.0 mM)

  • Reduce temperature to 16-25°C during induction to improve protein folding

  • Continue expression for 4-16 hours

Purification Approach:

  • For membrane protein LrgB, use detergent solubilization with mild detergents (DDM, LDAO)

  • Purify using affinity chromatography based on the chosen tag

  • Further purify using size exclusion chromatography

  • Verify protein purity using SDS-PAGE and Western blotting

What molecular techniques are most effective for studying LrgB-dependent phenotypes in Bacillus cereus?

Based on the research methodologies described in the search results, several effective techniques for studying LrgB-dependent phenotypes include:

Gene Deletion and Complementation:

  • Generation of single and double knockout mutants (ΔlrgB, ΔlrgAB, ΔgapBΔlrgAB) using plasmid-based genetic tools such as pMAD, which contains resistance markers and the heat-resistant bgaB gene

  • Complementation studies using plasmids like pAD123-Pgal to confirm phenotype restoration

Biofilm Quantification:

  • Crystal violet staining to quantitatively assess biofilm formation

  • Visual assessment of biofilm formation at both air-liquid (pellicle) and solid-liquid interfaces

  • Colony architecture analysis using techniques similar to those described by Diethmaier et al. (2014)

Gene Expression Analysis:

  • RNA extraction from B. cereus cultures at appropriate growth phases

  • Reverse transcription to generate cDNA

  • qRT-PCR using appropriate primers and reference genes (16S rRNA was used as endogenous control in the referenced research)

  • Calculation of relative expression using the -ΔΔCT method

Cell Viability Assessment:

  • Fluorescence microscopy with live/dead staining to differentiate between living and dead cells within biofilms

  • Quantitative analysis of cell proportions in different genetic backgrounds

How might post-translational modifications of LrgB affect its function in regulating biofilm formation?

Post-translational modifications (PTMs) of LrgB potentially represent an unexplored regulatory mechanism affecting biofilm formation in B. cereus. While the search results don't directly address PTMs of LrgB, this represents an important avenue for advanced research.

The functional connection between GapB (a metabolic enzyme) and LrgB suggests that LrgB activity might be influenced by the metabolic state of the cell. Potential PTMs that could regulate LrgB function include:

  • Phosphorylation: As a common regulatory modification, phosphorylation could alter LrgB's activity in response to cellular signaling cascades. Researchers should investigate whether LrgB contains conserved phosphorylation sites and whether kinases associated with stress responses or biofilm formation interact with LrgB.

  • Redox-based modifications: Given that biofilm formation often occurs under oxidative stress conditions, cysteine residues in LrgB might undergo oxidation, S-glutathionylation, or other redox-based modifications that could alter protein function.

  • Proteolytic processing: Some membrane proteins require proteolytic cleavage for full activity. Researchers should investigate whether LrgB undergoes processing and how this might be regulated in response to environmental conditions.

Methodological approaches to study these modifications would include mass spectrometry-based proteomics, site-directed mutagenesis of potential modification sites, and in vitro biochemical assays to assess how modifications affect LrgB's interaction with membrane components or regulatory partners.

What is the evolutionary relationship between LrgB proteins across different Bacillus species, and how does this impact functional specialization?

Evolutionary analysis of LrgB across Bacillus species would provide valuable insights into functional adaptation and specialization. Although the search results don't directly address evolutionary aspects, we can formulate research approaches based on comparative genomics principles:

Researchers should conduct phylogenetic analyses using LrgB sequences from B. cereus and related species including B. thuringiensis, B. weihenstephanensis, and B. subtilis (all mentioned in the search results) . Such analysis would likely reveal:

  • Conservation patterns: Identifying highly conserved regions across species would highlight domains essential for core functions, while variable regions might indicate species-specific adaptations.

  • Selection pressures: Analysis of non-synonymous to synonymous substitution ratios (dN/dS) across the LrgB coding sequence would reveal whether certain regions are under positive or purifying selection.

  • Correlation with biofilm phenotypes: Mapping sequence variations to known differences in biofilm formation capabilities between species could identify key residues responsible for functional specialization.

  • Co-evolution with interaction partners: Analysis of evolutionary rates between LrgB and its putative interaction partners (including LrgA and possibly GapB) could reveal co-evolutionary relationships that maintain functional interactions.

Experimental validation of evolutionary insights could involve creating chimeric proteins with domains from different species' LrgB variants and testing their functionality in biofilm formation assays.

How should researchers interpret conflicting data regarding LrgB's role in different Bacillus cereus strains?

When confronted with conflicting data regarding LrgB function across B. cereus strains, researchers should implement a systematic analytical approach:

1. Strain-specific genetic context analysis:

  • Examine the genomic neighborhood of lrgB across strains

  • Identify polymorphisms in the lrgB gene and its promoter region

  • Assess copy number variations or the presence of paralogs

2. Experimental condition standardization:

  • Carefully control growth conditions, as biofilm formation is highly sensitive to environmental factors

  • Document media composition, temperature, and growth phase when making comparisons

  • Consider using defined minimal media to eliminate variability from complex media components

3. Quantitative phenotype measurement:

  • Employ multiple complementary techniques to measure biofilm formation (crystal violet staining, confocal microscopy, biomass determination)

  • Report quantitative metrics rather than qualitative observations

  • Include appropriate statistical analyses with sufficient biological replicates

4. Genetic complementation verification:

  • Perform comprehensive genetic complementation studies to confirm phenotypes are specifically due to lrgB variation

  • Use both native promoters and controlled expression systems to distinguish between regulatory and functional differences

5. Phenotypic context consideration:
The study in the search results shows that "GapB regulated the B. cereus 0-9 biofilm formation independently of the exopolysaccharides and regulatory proteins in the typical SinI/R system" . This indicates that different strains may utilize distinct regulatory pathways for biofilm formation, and LrgB's role should be interpreted within the context of strain-specific regulatory networks.

What statistical approaches are most appropriate for analyzing quantitative data on LrgB-dependent biofilm formation?

Robust statistical analysis is essential for meaningful interpretation of LrgB's role in biofilm formation. Based on current research practices, the following approaches are recommended:

1. Descriptive statistics and data visualization:

  • Present data using box plots or violin plots rather than simple bar graphs to show distribution characteristics

  • Report mean, median, and measures of dispersion (standard deviation, interquartile range) for all quantitative measurements

  • Generate heat maps for multi-parameter analyses to visualize correlations between different variables

2. Inferential statistical tests:

  • For comparing biofilm formation between two strains (e.g., wild-type vs. ΔlrgB): unpaired t-test (parametric) or Mann-Whitney U test (non-parametric)

  • For multiple strain comparisons: one-way ANOVA with appropriate post-hoc tests (Tukey's or Dunnett's)

  • For experiments with multiple variables (strain, media, temperature): multi-factor ANOVA or mixed-effects models

3. Correlation and regression analyses:

  • Assess relationships between lrgB expression levels and biofilm formation using regression analysis

  • Use multiple regression when examining the influence of several factors simultaneously

  • Consider non-linear regression models as biological relationships are often non-linear

4. Specialized analyses for particular data types:

  • For gene expression data (qRT-PCR): normalize to appropriate reference genes and use the -ΔΔCT method as described in the research methodology

  • For microscopy-based analyses: employ image quantification software with appropriate controls for background and thresholding

5. Sample size and power calculations:

  • Determine appropriate sample sizes through power analysis before experiments

  • Report effect sizes along with p-values to indicate biological significance in addition to statistical significance

What control strains should be included when investigating LrgB function in biofilm formation experiments?

A comprehensive experimental design for investigating LrgB function should include the following control strains:

1. Genetic control strains:

  • Wild-type B. cereus strain (positive control for normal biofilm formation)

  • ΔlrgB single deletion mutant (to assess LrgB-specific effects)

  • ΔlrgAB double deletion mutant (to assess the combined effect of the LrgAB system)

  • ΔlrgB complemented with wild-type lrgB (to confirm phenotype restoration)

  • ΔlrgB complemented with site-directed mutants of lrgB (to assess the importance of specific residues/domains)

2. Regulatory pathway controls:

  • ΔgapB mutant (as GapB appears to regulate LrgAB expression)

  • ΔgapBΔlrgAB double mutant (to examine the relationship between these regulatory components)

  • Strains with mutations in other biofilm regulatory systems (e.g., SinI/R system) to distinguish between parallel regulatory pathways

3. Species/strain comparative controls:

  • Related Bacillus species (B. thuringiensis, B. weihenstephanensis) to examine species-specific differences

  • Multiple B. cereus isolates from different sources to assess strain-to-strain variation

4. Expression level controls:

  • Strains with inducible lrgB expression systems to examine dose-dependent effects

  • Reporter strains with fluorescent protein fusions to monitor lrgB expression in real-time during biofilm development

The research described in the search results employed several of these control strains, including wild-type B. cereus 0-9, ΔgapB (SL1002), ΔlrgAB, and ΔgapBΔlrgAB mutants, as well as complemented strains . This comprehensive approach allowed researchers to establish that "GapB is involved in the extracellular DNA release and biofilm formation by regulating the expression or activities of LrgAB."

What environmental and experimental factors most significantly affect LrgB-dependent phenotypes?

When designing experiments to investigate LrgB function, researchers should carefully control the following factors that significantly influence biofilm formation and LrgB-dependent phenotypes:

1. Growth medium composition:

  • Different media formulations can dramatically alter biofilm structure and gene expression

  • The research described in the search results utilized both LBS medium and KBMS (King broth medium supplemented with glucose)

  • Consider testing defined minimal media in addition to complex media to identify specific nutritional triggers

2. Temperature and incubation conditions:

  • B. cereus biofilm experiments were conducted at 30°C in the described research

  • Temperature fluctuations can affect gene expression and protein function

  • Static versus shaking conditions dramatically influence biofilm architecture

3. Growth phase and cell density:

  • The timing of sample collection is critical, as gene expression patterns change throughout growth

  • For RNA extraction, the researchers harvested cells at OD600 of 0.8-1.0

  • For colony architecture analysis, cultures were standardized to specific optical densities (OD600 of 0.6-0.8)

4. Surface properties for biofilm attachment:

  • Material composition and surface characteristics significantly affect initial attachment

  • Surface pretreatment or conditioning can influence biofilm development

5. Experimental timeline:

  • Biofilm formation should be assessed at multiple time points to capture development dynamics

  • The research mentioned assessment after 2-3 days of incubation for colony architecture

6. Genetic background considerations:

  • Strain selection is critical as natural variation exists in biofilm-forming capacity

  • The specific B. cereus 0-9 strain in the research had previously characterized biofilm properties

7. Environmental stress factors:

  • Oxygen availability, pH, and nutrient limitation can trigger biofilm formation

  • Consider introducing controlled stressors to examine LrgB function under stress conditions

A methodical experimental design that controls or systematically varies these factors will enable researchers to obtain reproducible results and identify specific conditions where LrgB function is most pronounced or altered.

What emerging technologies could advance our understanding of LrgB's molecular mechanisms in biofilm formation?

Several cutting-edge technologies hold promise for elucidating LrgB's precise molecular mechanisms:

1. Cryo-electron microscopy (Cryo-EM):

  • Determination of LrgB's membrane protein structure in its native environment

  • Visualization of LrgB organization within the bacterial membrane during different stages of biofilm formation

  • Potential to capture conformational changes associated with protein activity

2. Advanced microscopy techniques:

  • Super-resolution microscopy (STORM, PALM) to visualize LrgB localization within single cells during biofilm formation

  • Correlative light and electron microscopy (CLEM) to connect LrgB localization with ultrastructural features of the biofilm matrix

  • Live-cell imaging with fluorescent protein fusions to track LrgB dynamics in real-time

3. High-throughput genetic approaches:

  • CRISPR interference (CRISPRi) for tunable repression of lrgB expression

  • Transposon sequencing (Tn-Seq) to identify genetic interactions with lrgB

  • Bar-coded deletion libraries to assess the biofilm phenotypes of thousands of mutants simultaneously

4. Systems biology approaches:

  • Multi-omics integration (transcriptomics, proteomics, metabolomics) to create comprehensive models of LrgB's role in biofilm regulation

  • Network analysis to position LrgB within the broader regulatory landscape of B. cereus

  • Computational modeling of biofilm formation incorporating molecular-level details of LrgB function

5. Protein-protein interaction detection:

  • Proximity labeling techniques (BioID, APEX) to identify proteins that interact with LrgB in living cells

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction surfaces and conformational changes

  • Single-molecule techniques to measure binding kinetics between LrgB and potential interaction partners

6. Phage-derived detection technologies:

  • Adapting detection methods similar to those described for B. cereus using bacteriophage-derived proteins

  • Development of LrgB-specific binding proteins for research and diagnostic applications

Implementing these technologies would provide unprecedented insights into how LrgB functions at the molecular level to regulate biofilm formation in B. cereus.

What are the potential applications of LrgB research in controlling biofilm formation in clinical and industrial settings?

Research on LrgB has significant translational potential for biofilm control strategies:

1. Development of anti-biofilm therapeutics:

  • Small molecule inhibitors targeting LrgB function could disrupt B. cereus biofilm formation

  • Peptide mimetics based on LrgB functional domains might interfere with biofilm regulatory pathways

  • Combination approaches targeting both LrgB and GapB systems could provide synergistic effects

2. Diagnostic applications:

  • LrgB-based detection systems for rapid identification of B. cereus in clinical or food samples

  • Development of biosensors that respond to biofilm initiation through LrgB-dependent pathways

  • Integration with technologies similar to the "phage proteins for pathogen detection on LFAs" described in the search results

3. Industrial biofilm management:

  • Engineered surfaces with anti-LrgB activity to prevent B. cereus colonization in food processing equipment

  • Biofilm dispersal strategies based on modulating LrgB activity in established biofilms

  • Monitoring systems to detect early biofilm formation based on LrgB expression or activity

4. Agricultural applications:

  • Development of biofilm-resistant crops or storage facilities

  • Biocontrol strategies using LrgB modulators to prevent B. cereus contamination of agricultural products

  • Targeted approaches that specifically disrupt B. cereus biofilms without affecting beneficial microbiota

5. Fundamental research implications:

  • Understanding LrgB function may provide insights applicable to biofilm formation in other pathogenic bacteria

  • The GapB-LrgB regulatory pathway represents a novel connection between metabolism and biofilm formation that could be exploited in multiple bacterial species

  • Knowledge of extracellular DNA release mechanisms could inform broader strategies for biofilm control

The research demonstrates that "GapB is involved in extracellular DNA release and biofilm formation dependent on regulating the expression or activities of LrgAB." This regulatory relationship presents multiple intervention points for controlling biofilm formation in practical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.