Recombinant Bacillus cereus Cardiolipin synthase 2 (cls2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus cereus Cardiolipin Synthase 2 (cls2)

Recombinant Bacillus cereus Cardiolipin Synthase 2 (cls2) is a genetically engineered enzyme derived from the bacterium Bacillus cereus. Cardiolipin synthases are crucial for the synthesis of cardiolipin, a phospholipid essential for maintaining the structural integrity and function of bacterial membranes. In bacteria, cardiolipin plays a significant role in membrane stability, particularly under stress conditions such as high temperatures or acidic environments.

Function and Importance of Cardiolipin Synthase

Cardiolipin synthases catalyze the final step in cardiolipin biosynthesis, combining two phosphatidylglycerol molecules to form cardiolipin. This process is vital for bacterial survival and virulence, as cardiolipin helps modulate membrane fluidity and supports the function of membrane-bound proteins. In Bacillus cereus, cardiolipin synthase 2 (cls2) is involved in cardiolipin accumulation during stationary phase growth and under specific stress conditions.

Characteristics of Recombinant Bacillus cereus Cardiolipin Synthase 2

  • Expression and Source: Recombinant Bacillus cereus Cardiolipin Synthase 2 is typically expressed in Escherichia coli (E. coli), a common host for recombinant protein production due to its well-understood genetics and ease of manipulation.

  • Purity and Form: The recombinant enzyme is often purified to a high degree, typically greater than 85% as determined by SDS-PAGE, and is available in a lyophilized powder form.

  • Applications: It is used in research settings for studying bacterial membrane biology, cardiolipin synthesis pathways, and the role of cardiolipin in bacterial stress responses.

Research Findings and Data

While specific data on recombinant Bacillus cereus Cardiolipin Synthase 2 is limited, studies on cardiolipin synthases in general highlight their importance in bacterial physiology. For instance, in Staphylococcus aureus, cardiolipin synthases (cls1 and cls2) are crucial for modulating virulence and adapting to host environments by influencing sensor kinase activities .

Table: Characteristics of Recombinant Cardiolipin Synthases

ProteinSpeciesExpression HostPurityForm
Cls1Bacillus cereusE. coli>90%Lyophilized powder
Cls2Staphylococcus aureusE. coli>90%Lyophilized powder
Cls2Bacillus cereusNot specified≥85%Not specified

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it to enable preferential development.
Synonyms
cls2; BC_1191; Cardiolipin synthase 2; CL synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-514
Protein Length
full length protein
Species
Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)
Target Names
cls2
Target Protein Sequence
MKNTLKLIFFILLLFALFVSLRMFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVI FLENRHPSKTLTWLIVLGIFPVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHED YEERILRNHKHQELLFRLADRLGALNISFQTETRTLTNGDETFRAILNGLKRAKHHIHME YYIVRDDKLGTEIKDILIQKSKEGVVVRFLYDAVGSFKLSKSYIEELNDAGVEMIPFFPV RFPILNDKINYRNHRKIVVIDGNEGFVGGLNIGDEYLGKNKYFGFWRDTHLYLRGEAVQS LQLIFLQDWFYMTGEAVLAPEYLQAKAVEGDHWGGVQLVAGGPDNKWETIKHLYFAMIAS ARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLDAG VKIYEYEKGFLHSKIVIVDSDLASIGTANMDMRSFHLNFEVNAFLYDTDSIRKLVQDFKD DLEESSEIHGDHFHKRRLHRRIVESTYRLLSPLL
Uniprot No.

Target Background

Function

Function: Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.

Database Links

KEGG: bce:BC1191

STRING: 226900.BC1191

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.