Recombinant Bacillus cereus DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

DNA Translocation

The FtsK motor domain (αβ subdomains) forms a hexameric ring that translocates double-stranded DNA (dsDNA) at rates of ~5 kb/s . The γ subdomain directs translocation by recognizing polarized KOPS (FtsK orienting polar sequences) . In Bacillus cereus, this activity likely resolves chromosome dimers and ensures proper segregation during cell division .

Regulatory Roles

  • XerCD-mediated recombination: The γ subdomain interacts with Xer recombinases to resolve sister chromosome dimers at dif sites .

  • Coordination with cell division machinery: FtsK in Bacillus cereus likely recruits proteins like FtsQ, FtsL, and FtsI to the divisome, as observed in E. coli .

Biochemical Studies

  1. ATPase Activity: The αβ subdomains exhibit ATP-dependent DNA binding and translocation, confirmed through in vitro assays .

  2. DNA Sequence Specificity: The γ subdomain recognizes KOPS motifs, ensuring directional translocation toward dif sites .

Genetic and Cellular Impact

  • Chromosome Segregation: Deletion mutants of FtsK in Bacillus cereus likely lead to defects in nucleoid morphology and delayed cell separation, as seen in Deinococcus radiodurans and E. coli .

  • Post-Irradiation Recovery: In Deinococcus radiodurans, FtsK expression increases after gamma radiation, suggesting a role in DNA repair . While not directly studied in Bacillus cereus, this highlights potential conserved functions.

Comparative Analysis with Other Bacterial FtsK Proteins

FeatureBacillus cereus FtsKE. coli FtsKDeinococcus radiodurans FtsK
LocalizationSeptum (inferred)SeptumSeptum and nucleoid foci
DNA TranslocationDirected by KOPS sequencesDirected by KOPS sequencesStimulates XerCD-mediated recombination
Domain Structureαβγ subdomainsαβγ subdomainsαβγ subdomains
Key PartnersXer recombinases (inferred)XerCD, FtsZ, ZipAXerS, FtsZ, SpoIIIE

Data synthesized from .

Potential Applications

  1. Biotechnology: The recombinant FtsK protein could serve as a model for studying ATP-dependent DNA translocation mechanisms.

  2. Antibacterial Research: Targeting FtsK’s γ subdomain may disrupt chromosome segregation in Bacillus cereus, offering novel therapeutic strategies .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ftsK; BC_3793; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-793
Protein Length
full length protein
Species
Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)
Target Names
ftsK
Target Protein Sequence
MAKQKQRGTKAKARRTIKPTLYYEIVGLTLFALSIITILQLGVVGKSFVLFFRFFFGEWY IIGVLGVIALSVSFVIKRGWPNLLNKRLIGFYLIVLAILMFSHITLFNLLTKDGAVQNTS VIVSTKDNFFLEMKKGPDSVHLGGGMFGALMFATCYFLFDEVGAYIIGIILVILGILCIT NKHIGEVLAPVGRILRSQFQVMQGDYKDWRAKRTAEQTEKKKTTRSTRSKRAAEQEEIIE PMEEISIDPPIISNFTENYPVNEEEDKRIEVEQEELITSPFIEETPPIEEPKKKRGEKIV ESLESEAQAPPMQFSNVENKDYKLPSLDILKFPKNKQVTNENAEIYENARKLERTFQSFG VKAKVTKVHRGPAVTKYEVYPDMGVKVSKIVSLSDDLALALAAKDIRIEAPIPGKSAVGI EVPNSEVSMVTLREVLDSKANNHPEEKLLIGLGRDITGEAVLARLNKMPHLLVAGATGSG KSVCINGIIVSILMRAKPHEVKLMMIDPKMVELNVYNGVPHLLTPVVTDPKKASQALKKV VSEMERRYELFAHSGTRNIEGYNDYIKEHNSQSEAKQPELPYIVVIVDELADLMMVASSD VEDAIMRLAQMARAAGIHLIIATQRPSVDVITGVIKANIPSRIAFAVSSQTDSRTILDGG GAEKLLGRGDMLFIPIGASKPVRVQGAFLSDDEVERVVEYVIGQQKAQYQEDMIPQDVLD TKQEVEDELYDEAVQLVVEMQTASVSMLQRRFRVGYTRAARLIDAMEMNGVVGPYEGSKP REVLINDVQEKSS
Uniprot No.

Target Background

Function

Recombinant Bacillus cereus DNA translocase FtsK (ftsK): An essential cell division protein that coordinates cell division and chromosome segregation. The N-terminus is involved in the assembly of the cell division machinery. The C-terminus functions as a DNA motor, moving dsDNA in an ATP-dependent manner towards the dif recombination site located within the replication terminus region. It is required for Xer recombinase activation, enabling subsequent chromosome unlinking through recombination.

Database Links

KEGG: bce:BC3793

STRING: 226900.BC3793

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is DNA translocase FtsK in Bacillus cereus?

FtsK in Bacillus cereus is a multifunctional and multidomain protein involved in chromosome segregation during cell division. Similar to its well-characterized homolog in Escherichia coli, B. cereus FtsK functions as a DNA motor protein that translocates DNA to ensure proper chromosome segregation before septum closure. The protein prevents chromosomal DNA from being trapped by the closing division septum, which is particularly crucial when circular chromosomes remain interlinked due to concatenation or homologous recombination events . FtsK belongs to the FtsK/SpoIIIE family of DNA translocases that are widely distributed across bacterial species and play essential roles in DNA transport during various cellular processes.

How does FtsK contribute to cell division in Bacillus cereus?

FtsK contributes to cell division in B. cereus through multiple mechanisms. First, it ensures chromosomal DNA clearance from the division site by active DNA translocation, preventing chromosome guillotining during septum formation. Second, as observed in E. coli, FtsK likely serves as a checkpoint linking chromosome segregation with cell division progression. In E. coli, FtsK is targeted to the Z-ring by interacting with the FtsZ membrane anchors ZipA and FtsA . While the specific interactions in B. cereus may differ, FtsK's localization at the division site suggests similar roles in coordinating chromosome segregation with septum formation. Additionally, FtsK may recruit late cell division proteins involved in septum synthesis, similar to E. coli where FtsK recruits FtsQ, FtsL, and FtsI .

What is the structural organization of FtsK in Bacillus cereus?

Based on structural similarities with E. coli FtsK, the B. cereus FtsK protein is organized into distinct domains with specialized functions. The N-terminal domain contains transmembrane segments that anchor the protein to the cell membrane at the division site. The middle linker domain connects the membrane anchor to the C-terminal motor domain. The C-terminal domain can be further subdivided into α, β, and γ subdomains . The α and β subdomains form the ATP-dependent DNA translocase motor, while the γ subdomain recognizes specific DNA sequences that guide the direction of translocation. This structural organization enables FtsK to perform its dual functions in cell division: anchoring to the division machinery via its N-terminus while mediating DNA transport through its C-terminal motor domain.

How does FtsK function as a DNA motor protein?

FtsK functions as a DNA motor protein through its C-terminal domain, which forms a hexameric ring around double-stranded DNA. The α and β subdomains of the C-terminal region constitute the ATPase motor that drives DNA translocation . Upon ATP binding and hydrolysis, conformational changes in the protein generate the mechanical force needed to translocate DNA at high speeds, estimated to be several kilobases per second in related proteins. The γ subdomain recognizes specific DNA sequences analogous to KOPS (FtsK Orienting Polar Sequences) in E. coli, which guide the direction of translocation toward specific chromosomal regions . This directional translocation ensures that the terminus region of the chromosome, typically containing dif sites, is properly positioned for XerCD-mediated chromosome dimer resolution.

How is FtsK activity regulated during the cell cycle?

FtsK activity is tightly regulated during the cell cycle to coordinate chromosome segregation with cell division. Temporal regulation occurs through controlled recruitment to the division site, likely dependent on FtsZ ring assembly, as observed in other bacterial systems. Spatial regulation involves localization specifically to the division septum through interactions with other divisome components. The DNA translocation activity appears to be activated only when chromosomal DNA is detected at the division site, preventing premature DNA movement. Additionally, the recognition of specific DNA sequences by the γ subdomain provides directional control, ensuring that chromosomal DNA is moved away from the division site toward the terminus region. These regulatory mechanisms ensure that FtsK-mediated DNA translocation occurs at the right time and place during the cell cycle.

What techniques are used for expression and purification of recombinant B. cereus FtsK?

Recombinant B. cereus FtsK expression typically involves heterologous expression systems, with E. coli being the most common host. For full-length FtsK, which contains transmembrane domains, specialized E. coli strains designed for membrane protein expression (such as C41/C43 or LEMO21) are recommended. Expression typically uses a pET vector system with an inducible T7 promoter and affinity tags (His6 or GST) for purification. For functional studies, researchers often express only the C-terminal motor domain (FtsK50C), which is soluble and retains translocation activity. Purification protocols commonly include: (1) cell lysis by sonication or pressure disruption, (2) initial purification by metal affinity chromatography (for His-tagged proteins), (3) ion exchange chromatography, and (4) size exclusion chromatography to ensure homogeneity. Activity assessment using ATP hydrolysis assays should confirm proper folding and function before proceeding to more complex experiments.

How do mutations in the FtsK domains affect its function in B. cereus?

Mutations in different FtsK domains produce distinct functional defects, providing insights into structure-function relationships. Mutations in the N-terminal domain typically impair septum localization and integration with the divisome, leading to filamentation phenotypes similar to ftsK deletion strains. Walker A and B motif mutations in the C-terminal motor domain abolish ATPase activity and DNA translocation without affecting localization. These mutants can have dominant-negative effects when expressed in wild-type cells. Mutations in the γ subdomain disrupt DNA sequence recognition, resulting in non-directional translocation. This may lead to chromosome segregation defects despite normal ATPase activity, highlighting the importance of directional control. Linker domain mutations can affect the coupling between membrane anchoring and motor functions. Systematic mutagenesis studies enable mapping of residues critical for specific protein-protein interactions with divisome components or XerCD recombinases.

What are the differences between FtsK function in B. cereus and other bacterial species?

FtsK function shows both conservation and divergence across bacterial species, reflecting adaptation to different lifestyles and genome organizations. While E. coli FtsK is essential for viability and directly involved in recruiting late cell division proteins , B. cereus FtsK may have more specialized roles in chromosome segregation. As a spore-forming bacterium, B. cereus requires additional coordination between chromosome segregation, asymmetric division, and sporulation, potentially involving FtsK interactions with sporulation-specific proteins. The DNA sequence recognized by the γ domain likely differs between species, reflecting different chromosome architecture and organization. E. coli FtsK recognizes KOPS motifs (GGGNAGGG), while B. cereus FtsK likely recognizes distinct sequence motifs optimized for its genome . Additionally, differences in the N-terminal domain structure may reflect species-specific interactions with divisome components, while the motor domain likely retains higher conservation across species.

How does FtsK interact with other cell division proteins in B. cereus?

FtsK interactions with other cell division proteins orchestrate the coordination between chromosome segregation and septum formation in B. cereus. The N-terminal domain mediates most of these interactions, though specific binding partners in B. cereus remain to be fully characterized. Based on knowledge from model systems, FtsK likely interacts with early cell division proteins including FtsZ, potentially through intermediary proteins similar to FtsA or ZipA in E. coli . These interactions recruit FtsK to the division site. FtsK may also interact with late cell division proteins involved in peptidoglycan synthesis at the septum, similar to its role in recruiting FtsQ, FtsL, and FtsI in E. coli . In B. cereus specifically, FtsK may interact with SepF, which supports the recruitment of DNA translocase SftA to the Z-ring, suggesting potential coordination between multiple DNA translocases . These interactions position FtsK to serve as both a physical and functional link between the chromosome segregation and cell division machineries.

What role does FtsK play in resolving chromosome dimers in B. cereus?

FtsK plays a critical role in resolving chromosome dimers that form through homologous recombination during DNA replication in B. cereus. Similar to E. coli, B. cereus FtsK likely activates site-specific recombination at dif sites by the XerCD recombinase system . The process begins with FtsK recognizing and translocating toward the chromosome terminus region containing dif sites. Upon reaching these sites, the γ subdomain of FtsK interacts with XerD, stimulating its catalytic activity. This interaction triggers sequential strand exchanges by XerD and XerC, resolving chromosome dimers into monomers. Without this FtsK-dependent pathway, unresolved chromosome dimers would lead to segregation failures, guillotining of chromosomal DNA during cell division, and loss of genetic material. The specificity of FtsK-XerCD interactions likely reflects co-evolution of these systems to ensure proper coordination between cell division and chromosome dimer resolution.

What expression systems are optimal for recombinant B. cereus FtsK production?

The optimal expression system for recombinant B. cereus FtsK depends on the specific experimental goals and which domains are being studied. For full-length FtsK, membrane protein expression systems are necessary due to the N-terminal transmembrane domains. The bacterial expression system C43(DE3), derived from BL21(DE3), offers advantages for membrane protein expression with reduced toxicity. Expression should be conducted at lower temperatures (16-20°C) with reduced inducer concentrations to enhance proper folding. For the soluble C-terminal motor domain (FtsK50C), standard E. coli BL21(DE3) strains may be sufficient, with expression optimized at 25-30°C. Alternative hosts like Bacillus subtilis provide a more native membrane environment but typically yield lower protein quantities. For structural studies requiring high purity and homogeneity, insect cell expression systems (Sf9, High Five) provide superior post-translational processing. Codon optimization is essential when expressing B. cereus genes in heterologous hosts, as codon usage differences significantly impact translation efficiency and protein folding.

How can the ATPase activity of recombinant FtsK be measured in vitro?

ATPase activity measurement is essential for assessing FtsK motor function and can be performed using several complementary methods. The standard coupled enzymatic assay uses pyruvate kinase and lactate dehydrogenase to couple ATP hydrolysis to NADH oxidation, which is monitored spectrophotometrically at 340 nm. This real-time assay allows determination of kinetic parameters (Km, Vmax) and is sensitive to environmental conditions. The malachite green assay offers a simpler alternative by directly measuring released phosphate through a colorimetric reaction, though it provides endpoint rather than kinetic measurements. For high-throughput screening of FtsK mutants or inhibitors, a luminescence-based assay using luciferase to detect remaining ATP can be employed. Critically, all ATPase measurements should include controls testing DNA-dependent stimulation of activity, as FtsK's ATPase activity increases significantly in the presence of DNA substrates. Researchers should also assess how different DNA structures (circular, linear, supercoiled) and sequences affect ATPase rates to understand substrate specificity.

What assays can be used to study FtsK-mediated DNA translocation?

Multiple complementary assays can be employed to study FtsK-mediated DNA translocation, each providing different insights into this dynamic process. Single-molecule approaches offer the highest resolution: magnetic tweezers can measure translocation rates by tracking the rotation of DNA as FtsK moves along it, while optical tweezers directly measure forces generated during translocation. Fluorescence-based assays include triplex displacement assays, where FtsK displaces a fluorescently-labeled triplex-forming oligonucleotide from DNA, with displacement time correlating to translocation rate. FRET (Förster Resonance Energy Transfer) assays monitor distance changes between fluorescent labels on DNA or between DNA and protein during translocation. For directional preference studies, researchers can design DNA substrates with oriented sequence motifs and measure relative translocation rates in each direction. TPM (Tethered Particle Motion) assays, which track the Brownian motion of beads attached to DNA tethered to a surface, can detect FtsK-induced changes in DNA conformation. These assays should be complemented with ATPase measurements to correlate ATP consumption with translocation parameters.

How can researchers visualize FtsK localization in B. cereus cells?

Visualization of FtsK localization in B. cereus cells requires specialized techniques due to the challenging nature of this organism and the dynamic behavior of FtsK. Fluorescent protein fusions (using msfGFP, mCherry, or mNeonGreen) can be created by integrating the constructs at the native ftsK locus to maintain physiological expression levels. When working with B. cereus, which belongs to a group containing pathogenic members, researchers should consider using less virulent B. cereus group strains for safety . Localization imaging is best performed using structured illumination microscopy (SIM) or confocal microscopy to resolve the ring-like distribution at the division site. For temporal dynamics, time-lapse imaging with temperature-controlled microscopy stages is essential. Immunofluorescence microscopy using anti-FtsK antibodies provides an alternative that avoids potential artifacts from fluorescent protein fusions but requires fixation. Super-resolution techniques like PALM or STORM offer nanometer-scale resolution of FtsK organization within the divisome. Colocalization with other divisome proteins (labeled with spectrally distinct fluorophores) can reveal the timing of FtsK recruitment relative to other cell division events.

What are the key considerations for studying FtsK-XerCD interactions?

Studying FtsK-XerCD interactions requires careful experimental design to capture this transient, DNA-dependent process. In vitro recombination assays should use purified components (FtsK, XerC, XerD) with DNA substrates containing properly oriented dif sites. Researchers must ensure that the C-terminal domain of FtsK, particularly the γ subdomain responsible for XerD activation, is intact and properly folded. Protein-protein interaction studies can employ bacterial two-hybrid assays, fluorescence anisotropy with labeled protein domains, or surface plasmon resonance to measure binding kinetics. For structural studies, cross-linking followed by mass spectrometry can identify interaction interfaces. In vivo approaches include fluorescence colocalization microscopy and genetic suppressor screens to identify residues critical for functional interactions. When designing experiments, researchers should consider that FtsK-XerCD interactions are likely DNA-dependent and may require the proper DNA substrate to form stably. Additionally, ATP or non-hydrolyzable ATP analogs may be necessary to capture specific interaction states corresponding to different steps in the translocation-recombination pathway.

How can researchers address solubility issues with recombinant FtsK?

Solubility challenges with recombinant FtsK can be addressed through a systematic optimization approach. For full-length FtsK containing transmembrane domains, detergent screening is essential, with mild non-ionic detergents (DDM, LMNG) or lipid nanodiscs offering the best balance between solubilization efficiency and protein stability. Expression temperature reduction (to 16-18°C) and inducer concentration optimization can improve folding. Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) can enhance folding of complex domains. For studies focused on function rather than structure, truncation constructs containing only the C-terminal motor domain circumvent solubility issues while retaining translocation activity. Fusion tags beyond standard affinity tags, such as MBP or SUMO, can dramatically improve solubility. Buffer optimization should test various pH values (typically 7.0-8.5), salt concentrations (100-500 mM), and stabilizing additives (glycerol 5-10%, reducing agents). High-throughput thermal shift assays can rapidly identify conditions promoting protein stability. If aggregation persists, on-column refolding during purification may recover properly folded protein from inclusion bodies.

What are common pitfalls in FtsK functional assays and how to overcome them?

FtsK functional assays present several common pitfalls that researchers should anticipate and address. In ATPase assays, background ATP hydrolysis from contaminant ATPases can be eliminated through additional purification steps or controlled for with appropriate inactive FtsK variants. For translocation assays, DNA substrate preparation quality is critical—nicked or degraded DNA leads to erroneous measurements. Using commercially prepared, sequence-verified DNA substrates can minimize this issue. Single-molecule experiments require careful surface passivation to prevent non-specific protein or DNA interactions, achieved using BSA, casein, or PEG-coated surfaces. When analyzing translocation rates, researchers should account for the influence of buffer conditions, particularly salt concentration and pH, which significantly affect motor activity. Temperature fluctuations during measurements can cause inconsistent results, necessitating temperature-controlled experimental setups. For in vivo assays, overexpression artifacts may occur—validation with complementation of deletion strains using native-level expression constructs is essential. When studying directional translocation, using DNA substrates with multiple correctly oriented recognition sequences improves assay robustness and better reflects the genomic context.

How can contradictory results in FtsK localization studies be reconciled?

Contradictory results in FtsK localization studies can arise from various methodological differences and can be reconciled through comprehensive analysis. Fixation artifacts in immunofluorescence can alter protein localization patterns; comparing live-cell imaging with fixed-cell approaches helps identify such artifacts. Different fluorescent protein tags can affect protein functionality and localization—validation with multiple tags and complementation tests is essential. Cell growth phase significantly impacts FtsK localization, with patterns differing between exponential and stationary phases or during sporulation. Researchers should carefully standardize growth conditions and synchronize cultures when possible. Growth media composition affects cell cycle parameters and can alter localization timing; comparative studies should maintain consistent media. Strain background differences, particularly in regulatory systems affecting cell division, can cause seemingly contradictory results between studies. Cross-laboratory validation using identical strains and protocols can identify whether differences are biological or methodological. Three-dimensional imaging approaches (Z-stacks with deconvolution) provide more accurate localization information than single-plane imaging, which may miss off-plane structures. Finally, quantitative image analysis with consistent thresholding methods and statistical rigor should replace qualitative visual assessments.

How can researchers differentiate between direct and indirect effects of FtsK mutations?

Differentiating between direct and indirect effects of FtsK mutations requires a systematic experimental approach combining in vivo and in vitro methodologies. Direct effects can be confirmed through in vitro reconstitution with purified components—if a mutation affects ATPase activity or DNA binding with purified protein, the effect is likely direct. Domain-specific mutations help isolate functions; for example, C-terminal domain mutations affecting translocation without altering localization suggest direct effects on motor function. Suppresser mutant screening can identify interaction partners—second-site suppressors often occur in proteins directly interacting with the original mutated site. Biochemical approaches like cross-linking coupled with mass spectrometry can map interaction interfaces and confirm direct binding partners. For in vivo studies, rapid induction systems allow observation of immediate effects after FtsK variant expression, helping separate primary from secondary effects. Quantitative phenotyping coupled with mathematical modeling can distinguish direct contributors to phenotypes from downstream consequences. Site-directed mutagenesis targeting predicted functional residues based on structural information, followed by specific activity assays, provides strong evidence for direct mechanistic roles. Finally, comparing phenotypes across multiple cellular processes (division, segregation, gene expression) helps identify the primary affected pathway.

How is FtsK involved in bacterial pathogenesis in B. cereus?

FtsK's potential involvement in B. cereus pathogenesis represents an emerging research area with significant clinical implications. As a key cell division protein, FtsK indirectly affects pathogenesis by enabling rapid bacterial proliferation during infection. More directly, FtsK-mediated chromosome segregation ensures proper inheritance of virulence factors encoded on the chromosome, including those responsible for cereulide production, a heat-stable emetic toxin implicated in food poisoning . The efficiency of chromosome segregation may affect stress responses necessary for survival in host environments. Some evidence suggests that disruption of FtsK function leads to filamentation, which may alter bacterial interactions with host immune cells. In B. cereus, which can form biofilms during infection, FtsK's role in cell division impacts biofilm architecture and antibiotic resistance. The stress conditions encountered during infection (nutrient limitation, immune response) may specifically modulate FtsK activity and localization, potentially serving as environmental sensing mechanisms. Targeted studies using infection models with FtsK mutants could reveal direct contributions to virulence, with particular attention to potential roles in coordinating virulence gene expression with cell cycle progression.

What is the potential of FtsK as an antibacterial target in B. cereus infections?

FtsK presents several characteristics that make it a promising antibacterial target for B. cereus infections. As an essential cell division protein, inhibition of FtsK would likely prevent bacterial proliferation. The ATPase activity of the C-terminal motor domain offers a well-defined enzymatic target amenable to high-throughput screening approaches for inhibitor discovery. The uniqueness of FtsK's DNA translocase mechanism provides opportunities for selective targeting without affecting host cellular processes. Structural differences between bacterial FtsK and human DNA translocases enable the development of selective inhibitors with reduced off-target effects. Small molecules targeting the ATP binding pocket or DNA interaction surfaces could disrupt FtsK function. Alternatively, peptide inhibitors designed to disrupt essential protein-protein interactions between FtsK and other divisome components represent another targeting strategy. For food safety applications relevant to B. cereus, which is a common food contaminant, FtsK inhibitors could be developed as food preservatives that specifically target this pathogen . Preclinical development would require careful assessment of resistance mechanisms, as point mutations in FtsK could potentially confer resistance while maintaining essential function.

How does environmental stress affect FtsK function in B. cereus?

Environmental stress significantly impacts FtsK function in B. cereus, reflecting the bacterium's need to coordinate cell division with external conditions. Temperature extremes, relevant to B. cereus as a food contaminant, modulate FtsK activity, with implications for growth at refrigeration or cooking temperatures . Under nutrient limitation, FtsK localization and activity may be altered as part of the general stress response, potentially delaying cell division until conditions improve. Oxidative stress, encountered during host immune response, may damage FtsK directly or affect its interactions with other divisome components. In response to DNA damage, FtsK activity likely coordinates with SOS response proteins to prevent division until chromosome integrity is restored. The environmental matrix, whether food-based (cereal, dairy, meat) or host tissue, influences B. cereus growth dynamics and potentially FtsK regulation . During sporulation, triggered by severe nutrient depletion, FtsK activity is likely reprogrammed to support the asymmetric division and chromosome transport into the forespore compartment. Acidic conditions, encountered in certain foods or host compartments, may alter protein-protein interactions within the divisome network. Understanding these stress-responsive changes in FtsK function could reveal adaptation mechanisms and identify condition-specific vulnerabilities for targeted interventions.

What role does FtsK play in horizontal gene transfer in B. cereus?

FtsK may play previously unrecognized roles in horizontal gene transfer (HGT) in B. cereus, potentially influencing pathogenicity and evolutionary adaptability. As a DNA translocase, FtsK's ability to recognize and translocate specific DNA sequences could facilitate the movement of mobile genetic elements during cell division. The terminus region of bacterial chromosomes, where FtsK typically operates, often harbors integration hotspots for genomic islands and prophages. FtsK-mediated XerCD recombination, which normally resolves chromosome dimers, could potentially catalyze integration or excision of genetic elements containing dif-like sequences. During bacterial conjugation, FtsK might facilitate transfer of chromosomal DNA by ensuring proper processing of the terminus region. The diverse B. cereus group, which includes closely related species with varying pathogenicity profiles (as observed in outbreak investigations), shows evidence of extensive HGT affecting virulence traits . Whole genome sequencing of B. cereus isolates reveals mosaic genomes consistent with recombination events potentially involving FtsK-mediated processes . Experimental approaches examining conjugation efficiency or prophage excision rates in FtsK mutants could test these hypotheses. Understanding FtsK's potential contributions to HGT could reveal new dimensions of bacterial genome plasticity and virulence evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.