Recombinant Bacillus cereus Holin-like protein CidA 2 (cidA2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus cereus Holin-like protein CidA 2 (cidA2)

Bacillus cereus is a gram-positive, rod-shaped, facultative anaerobic bacterium commonly found in soil and food. While B. cereus is known for causing food poisoning through the production of various toxins, it also possesses sophisticated molecular mechanisms for cell death regulation and stress response. Among these mechanisms, the CidA/LrgA protein family plays a fundamental role in controlling bacterial programmed cell death and lysis processes.

Holin-like protein CidA 2 (cidA2) is a member of the CidA/LrgA protein family identified in Bacillus cereus strain ATCC 14579/DSM 31. The gene encoding this protein, designated as cidA2 (BC_3755), produces a transmembrane protein that functions similar to bacteriophage holins - proteins that create holes in the bacterial cytoplasmic membrane. This functional characteristic is central to the protein's biological role in bacterial physiology and stress response.

Recombinant cidA2 refers to the artificially produced version of this protein, typically expressed in systems such as Escherichia coli, to obtain purified protein for research applications. The production of recombinant cidA2 enables detailed structural and functional studies that would be difficult to conduct with naturally occurring protein in B. cereus.

Physical and Chemical Properties

Table 1: Physical and Chemical Properties of Recombinant cidA2

PropertyCharacteristic
Molecular WeightNot specifically stated in sources
Subcellular LocationCell membrane; Multi-pass membrane protein
UniProt AccessionQ81A38
Gene LocationBC_3755
Expression Region1-118 (full length)
Protein FamilyCidA/LrgA family, CidA subfamily

The protein belongs to the CidA/LrgA family and specifically to the CidA subfamily, which is characterized by proteins involved in controlling murein hydrolase activity and bacterial programmed cell death. This classification provides insights into its evolutionary relationships and functional similarities with other bacterial proteins.

Primary Function

The primary function of cidA2 appears to be enhancing the activity of extracellular murein hydrolases by facilitating their export through pore formation in the bacterial cell membrane. Murein hydrolases are enzymes that degrade peptidoglycan, the major structural component of bacterial cell walls. By regulating the activity of these enzymes, cidA2 plays a crucial role in controlling cell wall integrity and bacterial cell death.

The mechanism of action of cidA2 involves oligomerization within the bacterial cell membrane under stress conditions. This oligomerization creates lesions that disrupt the proton motive force, leading to cell death. Additionally, these membrane lesions likely regulate subsequent cell lysis by either providing access to the cell wall substrate for murein hydrolases or influencing their activity through alterations in cell wall pH caused by the loss of membrane potential.

Regulation and Interaction with LrgAB

A significant aspect of cidA2 function is its interaction with antiholin-like proteins LrgAB. In unstressed bacterial cells, LrgAB products are believed to inhibit CidA activity, thereby preventing premature cell death and lysis. This regulatory mechanism represents a sophisticated control system that allows bacteria to modulate cell death and lysis in response to environmental conditions.

When bacterial cells encounter stress, such as antibiotic exposure or other adverse environmental factors, the inhibitory effect of LrgAB may be reduced, allowing cidA2 to form membrane pores and initiate the cell death process. This stress-responsive regulation ensures that bacterial programmed cell death occurs only under appropriate conditions.

Expression Systems

Recombinant Bacillus cereus Holin-like protein CidA 2 is typically produced using in vitro E. coli expression systems. This approach allows for the controlled production of significant quantities of the protein for research purposes. The recombinant expression process involves cloning the cidA2 gene into appropriate expression vectors, transforming these vectors into E. coli host cells, and inducing protein expression under optimized conditions.

The choice of expression system and conditions can significantly affect the yield, solubility, and activity of the recombinant protein. For membrane proteins like cidA2, special considerations may be necessary to ensure proper folding and membrane insertion.

Purification and Formulation

After expression, recombinant cidA2 undergoes purification processes to remove host cell proteins and other contaminants. The purified protein is typically formulated in appropriate buffers to maintain stability and activity. Commercial preparations of recombinant cidA2 are available in different forms:

Table 2: Available Forms of Recombinant cidA2

FormBuffer CompositionApplications
Lyophilized powderTris/PBS-based buffer with 6% Trehalose before lyophilizationLong-term storage, shipping
SolutionTris-based buffer with 50% glycerol Ready-to-use applications

The lyophilized form offers advantages for long-term storage and shipping, while the solution form may be more convenient for immediate research applications. The specific formulation may vary depending on the manufacturer and intended use.

Reconstitution and Preparation

For lyophilized recombinant cidA2, proper reconstitution is essential to ensure full recovery of activity. The recommended reconstitution procedure involves:

  1. Centrifuging the vial briefly before opening to ensure the contents settle at the bottom

  2. Reconstituting the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL

  3. Adding glycerol to a final concentration of 5-50% for long-term storage

  4. Preparing small aliquots for storage at -20°C/-80°C

The shelf life of reconstituted protein is approximately 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of about 12 months at the same storage conditions.

Bacterial Cell Death Studies

Recombinant cidA2 serves as a valuable tool for studying bacterial programmed cell death mechanisms. By investigating the function and regulation of cidA2, researchers can gain insights into how bacteria control cell lysis and death in response to environmental stressors. These studies contribute to our understanding of bacterial survival strategies and population dynamics.

Antimicrobial Research

The role of cidA2 in bacterial cell death makes it a potential target for antimicrobial drug development. Research into compounds that can modulate cidA2 activity could lead to novel antibiotics that trigger bacterial self-destruction. Additionally, understanding the interaction between cidA2 and antiholin-like proteins LrgAB may provide new strategies for overcoming antibiotic resistance.

Protein-Protein Interaction Studies

Recombinant cidA2 can be used to study interactions with other bacterial proteins, particularly those involved in cell wall metabolism and stress response. These interaction studies can reveal regulatory networks that control bacterial survival and death under various environmental conditions.

Relationship to Other CidA Proteins

Table 3: Comparison with Related Proteins (Based on Available Information)

ProteinOrganismFamilyKey Features
CidA2Bacillus cereusCidA/LrgA family, CidA subfamilyHolin-like function, enhances murein hydrolase activity
CidABacillus cereusCidA familyLikely similar holin-like function
CidA (in other bacteria)Various gram-positive bacteriaCidA familyControl of murein hydrolase activity, involved in biofilm formation and antibiotic tolerance in some species

Evolutionary Conservation

The presence of cidA2 in Bacillus cereus and similar proteins in other bacterial species suggests evolutionary conservation of this cell death regulatory mechanism. This conservation highlights the fundamental importance of controlled cell death and lysis in bacterial physiology and adaptation to environmental stress.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference in the order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for a maximum of one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cidA2; BC_3755; Holin-like protein CidA 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)
Target Names
cidA2
Target Protein Sequence
MKYVTLLLQVGVLYVFSLVGTWIQGVFHLSMPGSLIGMLILFLLLSTRVLPLKWFELGAE KLIVFLPLFLIPSTTGLMEYGSFLFSKESIIFLLVVASTVVTLIVSGYISQLLITTKK
Uniprot No.

Target Background

Function
CidA2, a holin-like protein, enhances the activity of extracellular murein hydrolases potentially by facilitating their export via pore formation. Its function is inhibited by the antiholin-like proteins LrgAB. In unstressed cells, LrgAB products likely inhibit CidA activity. When a cell experiences stress, such as antibiotic exposure or other environmental factors, CidA may oligomerize within the bacterial cell membrane, creating lesions that disrupt the proton motive force, leading to cell death. These lesions are also believed to regulate subsequent cell lysis, potentially by granting access to the cell wall substrate for murein hydrolases or influencing their activity through alterations in cell wall pH caused by the loss of membrane potential.
Database Links

KEGG: bce:BC3755

STRING: 226900.BC3755

Protein Families
CidA/LrgA family, CidA subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should researchers properly handle and store recombinant cidA2 protein to maintain activity for experiments?

Proper handling of recombinant cidA2 protein requires careful attention to storage conditions and reconstitution protocols. The lyophilized protein should be stored at -20°C to -80°C upon receipt, with aliquoting necessary for multiple use scenarios . Repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein integrity and activity .

For reconstitution, researchers should:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% being optimal) for long-term storage

  • Store working aliquots at 4°C for no more than one week

This methodology preserves structural integrity and functional activity of the protein for experimental applications.

How does cidA2 relate to other virulence factors in the Bacillus cereus group?

Research indicates B. cereus pathogenicity involves multiple regulatory systems, including the PlcR regulon that controls numerous virulence factors . While cidA2 is not directly mentioned as part of the PlcR regulon, the contextual understanding of B. cereus virulence suggests potential interactions with this regulatory network. The PlcR virulence regulon controls approximately 45 genes that encode primarily exported proteins involved in food supply acquisition, cell protection, and environmental sensing .

What expression systems are most effective for producing functional recombinant cidA2 protein?

For optimal expression of recombinant cidA2, Escherichia coli has proven to be an effective heterologous host system. Current methodologies typically employ E. coli expression systems with N-terminal His-tag fusion for simplified purification . This approach allows for:

  • High-yield protein production

  • Simplified purification through affinity chromatography

  • Maintenance of protein structure and function

Key considerations for optimizing expression include:

ParameterRecommended ConditionsRationale
Expression hostE. coli BL21(DE3) or similar strainsReduced protease activity; T7 RNA polymerase system
Growth temperature16-25°C after inductionSlower expression minimizes inclusion body formation
Induction OD₆₀₀0.6-0.8Optimal cell density for protein expression
IPTG concentration0.1-0.5 mMLower concentrations may improve soluble protein yield
Post-induction time16-20 hoursExtended expression at lower temperatures

Researchers should particularly monitor growth conditions closely, as membrane proteins like cidA2 can become toxic to host cells when overexpressed .

What analytical techniques are most informative for studying cidA2's membrane interactions and potential pore-forming activity?

Investigating cidA2's membrane interactions requires multiple complementary approaches:

  • Liposome leakage assays: These provide quantitative measures of pore formation by monitoring the release of fluorescent markers from liposomes upon exposure to cidA2. Researchers should prepare liposomes with lipid compositions mimicking bacterial membranes for physiological relevance.

  • Planar lipid bilayer electrophysiology: This approach allows direct measurement of pore formation and conductance. Properly designed experiments can determine pore size, ion selectivity, and gating properties of cidA2-formed channels.

  • Fluorescence microscopy with labeled protein: By tagging cidA2 with fluorescent probes, researchers can visualize its localization in bacterial membranes and track dynamic changes during cellular events.

  • Atomic Force Microscopy (AFM): AFM provides high-resolution imaging of cidA2's interaction with membranes and can reveal structural changes induced in the bilayer.

  • Circular Dichroism (CD) spectroscopy: Vital for confirming proper protein folding and secondary structure in different membrane-mimicking environments.

These methods should be applied in combination to develop a comprehensive understanding of cidA2's membrane biology, as singular approaches may provide incomplete mechanistic insights .

How can researchers effectively validate that recombinant cidA2 maintains its native structural properties?

Validation of recombinant cidA2's structural integrity requires multiple complementary approaches:

  • SDS-PAGE and Western blotting: Confirm protein purity and identity. The protein should show >90% purity with a single band at approximately 13 kDa (accounting for the His-tag) .

  • Mass spectrometry: Peptide mass fingerprinting confirms the protein sequence and identifies any post-translational modifications or truncations.

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure content, particularly important for confirming proper folding of membrane proteins.

  • Thermal shift assays: Evaluate protein stability under different buffer conditions.

  • Dynamic light scattering (DLS): Assess protein homogeneity and detect aggregation.

  • Functional assays: Membrane permeabilization or liposome leakage assays that demonstrate expected biological activity provide the strongest evidence for proper folding.

When comparing results to published literature, researchers should consider that differences in expression systems, purification methods, and buffer conditions can influence protein structure and function .

How might cidA2 interact with the PlcR virulence regulatory network in Bacillus cereus?

The relationship between cidA2 and the PlcR virulence regulon represents an intriguing research area. PlcR is a transcriptional regulator in B. cereus that controls numerous virulence factors by binding to specific nucleotide sequences called "PlcR boxes" located upstream of regulated genes . While cidA2 is not explicitly identified as part of the PlcR regulon in the available literature, several investigative approaches can elucidate potential interactions:

  • Promoter analysis: Researchers should examine the upstream region of the cidA2 gene for PlcR box consensus sequences (TATGnAnnnnTnCATA or ATGhAwwwwTdCAT) . This bioinformatic approach can identify potential regulatory relationships.

  • Comparative transcriptomics: Compare cidA2 expression levels between wild-type B. cereus and ΔplcR mutant strains using RT-qPCR or RNA-seq. Differential expression would suggest PlcR regulation.

  • Chromatin immunoprecipitation (ChIP): Use ChIP assays with PlcR antibodies to determine if PlcR directly binds to the cidA2 promoter region.

  • Reporter gene assays: Create cidA2 promoter-lacZ fusions and measure expression in various genetic backgrounds to confirm regulatory relationships.

The PlcR regulon currently includes 45 genes controlled by 28 PlcR boxes, with 40 of the regulated proteins being exported (22 secreted and 18 cell wall-associated) . Understanding whether cidA2 integrates into this network would provide valuable insights into B. cereus virulence regulation.

What methodological approaches can determine cidA2's specific role in Bacillus cereus pathogenicity?

Determining cidA2's contribution to B. cereus pathogenicity requires sophisticated experimental approaches:

  • Gene knockout studies: Create cidA2 deletion mutants and compare their virulence to wild-type strains in appropriate infection models. This requires:

    • Precise gene targeting using homologous recombination

    • Confirmation of successful deletion through PCR and sequencing

    • Complementation studies to verify phenotypes are specifically due to cidA2 loss

  • Infection models: Various models should be employed to comprehensively assess virulence:

    Model TypeApplicationMeasurements
    Cell cultureCytotoxicity assessmentCell viability, membrane integrity, cytokine production
    Insect models (G. mellonella)Intermediate complexitySurvival rates, bacterial loads, hemocyte responses
    Mammalian modelsComprehensive virulence assessmentTissue colonization, inflammatory markers, survival
  • Transcriptomics and proteomics: Compare global gene/protein expression patterns between wild-type and ΔcidA2 strains during infection to identify affected pathways.

  • Protein-protein interaction studies: Identify interaction partners of cidA2 using pull-down assays, bacterial two-hybrid systems, or co-immunoprecipitation followed by mass spectrometry.

  • Virulence factor expression analysis: Quantify expression of known virulence factors (HBL, NHE, CytK) in the presence and absence of cidA2 .

These approaches should be integrated to develop a comprehensive understanding of cidA2's pathogenic contributions, as B. cereus virulence is multifactorial and complex .

What are the methodological challenges in studying potential interactions between cidA2 and other bacterial holin systems?

Investigating interactions between cidA2 and other holin systems presents several methodological challenges:

  • Membrane protein purification: Obtaining sufficient quantities of properly folded membrane proteins remains technically challenging. Researchers must optimize detergent selection, purification buffers, and reconstitution protocols to maintain native structure.

  • Functional redundancy: Bacteria often possess multiple holin-like proteins with overlapping functions. Researchers should consider creating multiple gene knockouts to address potential compensation mechanisms.

  • Physiological relevance: In vitro studies may not fully recapitulate the complex bacterial membrane environment. Experiments should incorporate membrane compositions that closely mimic natural bacterial membranes.

  • Protein-protein interaction detection: Traditional techniques like yeast two-hybrid are often unsuitable for membrane proteins. Alternatives include:

    • Split-ubiquitin systems specifically designed for membrane proteins

    • Bimolecular fluorescence complementation (BiFC)

    • Förster resonance energy transfer (FRET) with carefully positioned fluorophores

  • Dynamic nature of interactions: Holin interactions often occur transiently during specific cellular events. Time-resolved techniques and inducible expression systems may be necessary to capture these dynamics.

By systematically addressing these challenges, researchers can develop more complete models of how cidA2 functions within the broader context of bacterial membrane regulation and cell death pathways.

How should researchers interpret cidA2 expression profiles in relation to Bacillus cereus virulence factor regulation?

Interpreting cidA2 expression data requires careful consideration of B. cereus regulatory networks. When analyzing expression profiles, researchers should:

  • Consider temporal expression patterns: Compare cidA2 expression timing with known virulence regulators like PlcR, which shows peak expression around the transition to stationary phase (t₀ to t₂) . This temporal correlation may suggest coordinated regulation.

  • Analyze growth phase dependencies: B. cereus virulence factor expression is highly growth phase-dependent. Researchers should sample multiple time points spanning exponential, transition, and stationary phases to capture complete expression dynamics.

  • Implement appropriate normalization strategies: For quantitative PCR studies, carefully select reference genes that maintain stable expression under experimental conditions. For RNA-seq data, apply appropriate normalization methods (e.g., DESeq2, edgeR) that account for library size differences.

  • Conduct multivariate analysis: Apply principal component analysis or hierarchical clustering to identify genes with similar expression patterns to cidA2, potentially revealing functional relationships.

  • Integrate with regulon data: Compare expression patterns with known regulons, particularly the PlcR regulon which comprises 45 genes controlled through 28 PlcR boxes and primarily encodes exported proteins involved in environmental adaptation .

  • Consider environmental context: B. cereus adapts its virulence expression based on environmental cues. Researchers should evaluate cidA2 expression under various conditions (temperature, pH, nutrient availability) that mimic different host environments.

This integrated approach allows researchers to position cidA2 within the complex regulatory networks governing B. cereus pathogenicity .

What statistical approaches are most appropriate for analyzing cidA2 structure-function relationship data?

Analyzing structure-function relationships for cidA2 requires robust statistical methodologies:

  • Multiple sequence alignment statistical analysis: When comparing cidA2 with other holin-like proteins, employ:

    • Position-specific scoring matrices to identify conserved functional domains

    • Mutual information analysis to detect co-evolving residues that may indicate functional relationships

    • Statistical coupling analysis to identify evolutionarily constrained residues

  • Mutation impact analysis: For site-directed mutagenesis studies:

    • Apply ANOVA with post-hoc tests when comparing multiple mutants

    • Use appropriate transformations (log, square root) when data violates normality assumptions

    • Implement mixed-effects models when analyzing data with repeated measurements

  • Structure prediction validation:

    • Use Ramachandran plot statistical analysis to validate predicted structures

    • Calculate RMSD values to quantify structural differences

    • Implement bootstrapping approaches to assess the robustness of predicted structures

  • Correlation analysis for structure-function relationships:

    • Apply multivariate regression when examining relationships between structural parameters and functional outcomes

    • Use principal component analysis to reduce dimensionality when analyzing multiple structural variables

    • Implement machine learning approaches (SVM, random forests) for complex datasets

These statistical approaches should be applied within the context of cidA2's sequence (118 amino acids) and its predicted membrane-spanning domains to develop meaningful structure-function relationships .

How might systems biology approaches advance our understanding of cidA2's role in bacterial physiology?

Systems biology offers powerful frameworks to contextualize cidA2 within broader bacterial networks:

  • Integrative multi-omics approaches: Combining transcriptomics, proteomics, and metabolomics data from wild-type and cidA2 mutant strains can reveal system-wide effects. This approach could identify unexpected pathways influenced by cidA2 beyond its predicted membrane functions.

  • Network analysis methodologies: Researchers should construct protein-protein interaction networks incorporating cidA2, potentially revealing:

    • Direct interaction partners

    • Pathway influences

    • Regulatory relationships

  • Mathematical modeling of membrane dynamics: Developing computational models of membrane properties that incorporate cidA2 function could predict:

    • Effects on membrane potential

    • Contribution to programmed cell death

    • Role in stress responses

  • Comparative genomics across Bacillus species: Analyzing cidA2 homologs across related species could reveal evolutionary patterns and functional conservation. Particular attention should be paid to differences between B. cereus, B. anthracis, and B. thuringiensis, which show complex interspecific relationships despite genetic similarity .

  • Single-cell analysis techniques: Applying technologies like single-cell RNA-seq or time-lapse microscopy to track cidA2 expression and activity at the individual cell level could reveal heterogeneity in expression and function within bacterial populations.

These systems approaches would complement traditional reductionist strategies and potentially reveal emergent properties not apparent from studying cidA2 in isolation .

What novel experimental techniques might overcome current limitations in studying cidA2 function?

Several emerging techniques hold promise for addressing current challenges in cidA2 research:

  • Cryo-electron microscopy: This rapidly advancing technique could reveal the three-dimensional structure of cidA2 in membrane environments at near-atomic resolution, providing crucial insights into its pore-forming mechanism.

  • Super-resolution microscopy: Techniques like STORM or PALM could visualize cidA2 localization in bacterial membranes with precision beyond the diffraction limit, potentially revealing spatial organization patterns and clustering behaviors.

  • Optogenetic control systems: Developing light-controlled cidA2 expression or activity systems would allow precise temporal control over protein function, enabling studies of acute effects on bacterial physiology.

  • Cell-free expression systems: These could overcome toxicity issues associated with membrane protein overexpression in living cells while maintaining proper folding and insertion into artificial membranes.

  • CRISPR interference (CRISPRi): This technology allows titratable repression of gene expression rather than complete knockout, enabling dose-dependent studies of cidA2 function and avoiding compensatory mechanisms that might obscure phenotypes in knockout strains.

  • Microfluidics-based assays: These systems permit precise control of environmental conditions and real-time monitoring of individual bacterial responses, providing insights into cidA2 function under dynamic conditions.

Implementation of these advanced techniques could significantly advance our understanding of cidA2's structural properties, dynamic behaviors, and functional roles in bacterial physiology and pathogenicity .

What integrated research approach would most effectively advance cidA2 research in the context of Bacillus cereus pathogenicity?

An effective integrated research strategy for cidA2 should combine multiple complementary approaches:

  • Structure-function correlation: Determine the three-dimensional structure of cidA2 through X-ray crystallography, NMR, or cryo-EM, then use structure-guided mutagenesis to identify critical functional domains.

  • Regulatory network mapping: Determine where cidA2 fits within known regulatory networks (particularly in relation to the PlcR regulon) using transcriptomics in various genetic backgrounds and growth conditions .

  • Pathogenicity model validation: Assess the contribution of cidA2 to virulence using genetically modified strains in appropriate infection models, measuring both colonization and disease progression.

  • Comparative analysis across Bacillus species: Examine functional conservation of cidA2 homologs across the B. cereus group, particularly in relation to the complex interspecific relationships with B. anthracis and B. thuringiensis .

  • Protein interaction mapping: Identify cidA2's interaction partners through proteomic approaches to contextualize its function within cellular networks.

This multifaceted approach would position cidA2 research within the broader context of B. cereus biology while maintaining focus on mechanistic details. The integration of these complementary methodologies would likely yield insights beyond what any single approach could provide.

What standardized protocols should researchers adopt to ensure comparability of cidA2 research findings?

To enhance reproducibility and facilitate meta-analysis, researchers should adopt standardized protocols:

  • Expression and purification: Standardize expression systems (preferably E. coli with His-tagging), purification methods, and quality control metrics including:

    • Minimum purity threshold (>90% by SDS-PAGE)

    • Consistent storage buffer composition (Tris/PBS-based buffer, 6% Trehalose, pH 8.0)

    • Validated reconstitution procedures

  • Experimental conditions: Report comprehensive details including:

    • Bacterial strains with complete genotypic information

    • Growth conditions (media composition, temperature, aeration)

    • Induction parameters (inducer concentration, timing, duration)

    • Buffer compositions with exact pH values

  • Data reporting standards: Include:

    • Raw data availability in public repositories

    • Detailed statistical methods with justification

    • Sample sizes and power calculations

    • Explicit declaration of technical and biological replicates

  • Genetic manipulation verification: For mutant strains, verify:

    • Precise genomic changes through sequencing

    • Absence of polar effects on neighboring genes

    • Complementation studies to confirm phenotype specificity

  • Contextual information: Report relevant parameters known to affect B. cereus physiology:

    • Growth phase at sampling/analysis points

    • Cell density measurements

    • Environmental conditions mimicking relevant host environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.