Recombinant Bacillus cereus Holin-like protein CidA (cidA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus cereus Holin-like Protein CidA (cidA)

The Recombinant Bacillus cereus Holin-like protein CidA (cidA) is a protein that belongs to the CidA/LrgA holin family . These proteins are named after CidA and LrgA of Staphylococcus aureus and are found in various bacteria and archaea . The CidA/LrgA family proteins typically range from 100 to 160 amino acid residues in length, though some can be larger .

Function and Role

CidA proteins are believed to be involved in programmed cell death, similar to apoptosis in eukaryotes . They influence biofilm formation by releasing DNA from lysed cells, which contributes to the biofilm matrix . CidA is thought to be the holin that exports the autolysin CidB, while LrgA may function as an anti-holin, inhibiting holin activity .

CidA and LrgA proteins, key regulators in bacterial programmed cell death, show structural similarities to bacteriophage holins, integral membrane proteins that control murein hydrolase activity . They are relatively small, possess two to three transmembrane domains, and have charge-rich N and C termini . These proteins oligomerize into high-molecular-mass complexes through disulfide bonds between cysteine residues .

CidA and LrgA in Staphylococcus aureus

In Staphylococcus aureus, the cidABC and lrgAB operons encode proteins, including CidA and LrgA, that play a role in programmed cell death . These proteins have holin-like properties and are involved in transporting small by-products of carbohydrate metabolism . Studies have indicated that CidA and LrgA can form pores in the cytoplasmic membrane, facilitating the transport of molecules .

Holin-like Activity and Cell Lysis

CidA and LrgA exhibit holin-like activity, supporting cell lysis when co-expressed with endolysin . Research has demonstrated that cell lysis resulting from the expression of CidA or LrgA is associated with the localization of these proteins in the membrane, leading to the formation of pores .

Impact on Biofilm Development

Mutations in cid and lrg operons can affect biofilm development and antibiotic tolerance . A mutant with altered cysteine residues in CidA showed increased cell lysis during the stationary phase and increased biofilm adhesion .

CidA and Overflow Metabolism

CidA and CidB modulate cell death by controlling overflow metabolic enzymes like CidC, involved in acetate production, and AlS/AlD, involved in acetoin production .

Experimental Evidence of Holin Activity

The "lysis cassette" system, employed to test the holin activity of CidA and LrgA, introduces the genes encoding these proteins into E. coli cells . Upon induction, cell lysis occurs, dependent on the coexpression of endolysin, suggesting that CidA and LrgA function similarly to holins by forming pores .

Functional similarities

Bacteriophage-encoded holins are diverse, characterized by small size, transmembrane domains, hydrophobicity, and the ability to oligomerize within the cytoplasmic membrane . CidA and LrgA share these characteristics, supporting their classification as holin-like proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
cidA; BCAH187_A3710; Holin-like protein CidA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Bacillus cereus (strain AH187)
Target Names
cidA
Target Protein Sequence
MKWWKLSGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGAD FLLKELILFFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSV Q
Uniprot No.

Target Background

Function

CidA, a holin-like protein from Bacillus cereus, enhances the activity of extracellular murein hydrolases, potentially by facilitating their export through membrane pore formation. Its function is inhibited by the antiholin-like proteins LrgAB. Under normal cellular conditions, LrgAB likely inhibits CidA activity. However, under stress (e.g., antibiotic exposure), CidA may oligomerize in the bacterial membrane, creating lesions that disrupt the proton motive force, leading to cell death. These lesions are also hypothesized to regulate cell lysis by enabling murein hydrolase access to the cell wall or by altering cell wall pH due to membrane potential loss.

Database Links
Protein Families
CidA/LrgA family, CidA subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the CidA protein in Bacillus cereus and how does it relate to the clhAB operon?

The CidA protein in Bacillus cereus is encoded by the clhAB operon, which is specific to the B. cereus group (including B. thuringiensis and B. anthracis). This operon encodes membrane proteins homologous to the Staphylococcus aureus CidA and CidB proteins that are involved in cell death control, particularly within glucose-grown cells . The clhAB-encoded proteins are integral membrane proteins with structural similarities to bacteriophage holins, containing transmembrane domains with characteristic charged C-terminal domains and polar N-termini .

How does B. cereus CidA function as a holin-like protein?

Based on studies of homologous proteins in S. aureus, the CidA protein functions as a holin-like protein by forming pores within the cytoplasmic membrane . These pores allow the transport of small molecules across the membrane. Typical of holins, CidA-induced lysis is dependent on the co-expression of endolysin, suggesting that CidA creates pores that allow endolysin to access the peptidoglycan layer . In B. cereus, the CidA protein (via the clhAB operon) modulates peptidoglycan hydrolase activity, which is required for proper cell shape and chain length during cell growth .

What phenotypic changes are observed when the cidA gene is deleted in B. cereus?

Deletion of the clhAB operon (which includes cidA) in B. cereus results in several phenotypic changes:

  • Formation of abnormally short cell chains regardless of the presence of glucose

  • Significantly wider cells compared to wild-type when grown in glucose (1.47 μm ±CI 95% 0.04 vs 1.19 μm ±CI 95% 0.03, respectively)

  • Accelerated autolysis under autolysis-inducing conditions

  • Alteration of the bacterial cell wall structure

These observations suggest that the CidA protein plays a critical role in cell morphology, chain formation, and regulation of autolytic activity in B. cereus.

How is the expression of cidA regulated in B. cereus?

The expression of cidA in B. cereus is regulated by at least two global transcriptional regulators:

  • CodY: Required for the basal level of clhAB (including cidA) expression under all conditions tested, including the transition growth phase . CodY is a branched-chain amino acid and GTP sensor and a global regulator of transcription in low G+C Gram-positive bacteria .

  • CcpA: The major global carbon regulator, needed for high-level expression of clhAB in glucose-grown cells . CcpA control appears to be exerted indirectly in the presence of glucose during late-exponential growth phase .

The activity of these regulators ensures appropriate expression of cidA under different nutritional conditions, particularly in response to glucose availability.

What role does glucose play in cidA expression and function in B. cereus?

Glucose significantly influences both the expression and function of cidA in B. cereus:

  • Glucose-grown cells of B. cereus ATCC 14579 form longer chains than those grown in the absence of glucose during the late exponential and transition growth phases .

  • The clhAB operon (containing cidA) is required for this chain-lengthening phenotype in glucose-rich conditions .

  • CcpA, the major global carbon regulator, is needed for high-level expression of clhAB in glucose-grown cells, suggesting a glucose-dependent regulatory mechanism .

  • Similar to S. aureus homologs, cidA expression is likely activated in glucose-grown cells and in the presence of acetate, suggesting metabolic regulation of its expression .

This glucose-dependent regulation indicates that CidA may play a specific role in cell morphology and chain formation when glucose is abundant in the environment.

What are the recommended approaches for generating recombinant B. cereus CidA protein?

For producing recombinant B. cereus CidA protein, researchers should consider the following methodological approach:

  • Gene cloning strategy: The cidA gene can be amplified from B. cereus genomic DNA using PCR with specific primers containing appropriate restriction sites. For proper expression, the gene should be cloned into an expression vector with an inducible promoter (e.g., T7 or tac).

  • Expression system optimization: Due to its membrane protein nature, CidA expression may be challenging. Consider using:

    • E. coli strains optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

    • Lower induction temperatures (16-25°C)

    • Reduced inducer concentrations

    • Fusion tags that enhance solubility (e.g., MBP, SUMO)

  • Purification approach: For membrane proteins like CidA:

    • Use mild detergents for solubilization (e.g., DDM, LDAO)

    • Implement affinity chromatography using His-tag or other fusion tags

    • Follow with size exclusion chromatography to obtain homogeneous protein

  • Functional verification: Assess the holin-like activity of the purified protein using:

    • Liposome leakage assays

    • Membrane vesicle experiments similar to those used for S. aureus CidA

This approach takes into account the challenges of working with membrane proteins while providing a pathway to obtain functional recombinant CidA.

What techniques are most effective for studying CidA localization and membrane pore formation?

To study CidA localization and pore formation effectively, researchers should consider these techniques:

  • Fluorescence microscopy with fusion proteins:

    • Generate CidA-fluorescent protein fusions (e.g., GFP, mCherry)

    • Use time-lapse microscopy to track localization during different growth phases

    • Implement super-resolution techniques (STED, PALM) for detailed membrane localization

  • Membrane vesicle assays:

    • Prepare membrane vesicles containing recombinant CidA

    • Measure leakage of fluorescent dyes of different molecular sizes to determine pore size

    • Compare leakage rates under different conditions (pH, temperature, ion concentrations)

  • Electrophysiology approaches:

    • Use black lipid membrane (BLM) techniques to measure conductance changes

    • Patch-clamp techniques on proteoliposomes containing CidA

    • These methods can provide direct evidence of pore formation and characterize pore properties

  • Cross-linking studies:

    • Implement chemical cross-linking to capture CidA oligomerization states

    • Use mass spectrometry to analyze cross-linked products

    • This can reveal how CidA proteins assemble to form functional pores

These methodologies, similar to those used for studying S. aureus CidA, would be appropriate for investigating B. cereus CidA's membrane localization and pore-forming capabilities .

How does CidA contribute to programmed cell death in B. cereus compared to other bacterial species?

The role of CidA in programmed cell death (PCD) in B. cereus shows both similarities and differences compared to other bacterial species:

Understanding these species-specific differences is crucial for developing a comprehensive model of bacterial PCD mechanisms and their evolutionary significance.

What is the relationship between CidA activity and peptidoglycan hydrolase modulation in B. cereus?

The relationship between CidA and peptidoglycan hydrolase activity in B. cereus represents a complex interaction:

  • Regulatory interaction:

    • The clhAB operon (containing cidA) modulates peptidoglycan hydrolase activity

    • Deletion of clhAB leads to accelerated autolysis, suggesting CidA normally downregulates certain autolysin activities

    • This indicates CidA may control the timing and extent of autolytic events

  • Structural basis:

    • CidA likely forms pores in the membrane that could control the access of autolysins to their substrate

    • The wider cell phenotype in ΔclhAB mutants suggests altered peptidoglycan architecture

    • This points to a role in coordinating cell wall synthesis and hydrolysis

  • Mechanistic model:

    AspectNormal CidA FunctionWithout CidA (ΔclhAB)
    Autolysis rateControlledAccelerated
    Cell widthNormal (~1.19 μm)Increased (~1.47 μm)
    Chain lengthLong chains in glucoseShort chains regardless of glucose
    Cell wall integrityMaintainedCompromised

This relationship is central to understanding how B. cereus maintains cell shape, controls cell division, and regulates autolysis during different growth phases and nutritional conditions.

How do the structural and functional properties of B. cereus CidA compare to homologs in other bacteria?

The structural and functional properties of B. cereus CidA show important similarities and differences compared to homologs in other bacterial species:

  • Structural comparison:

    • Like S. aureus CidA, B. cereus CidA likely contains transmembrane domains with a charged C-terminal domain

    • Both proteins are predicted to form oligomeric structures in the membrane

    • The specific number of transmembrane domains and topology may vary between species

  • Functional conservation:

    • Holin-like pore formation appears conserved, as evidenced by similar phenotypic effects

    • Role in modulating autolysis is consistent across species

    • Both are regulated by carbon metabolism, particularly glucose availability

  • Species-specific adaptations:

    • B. cereus CidA uniquely affects cell chain formation, a property not prominently reported in other species

    • Regulatory mechanisms differ, with B. cereus employing CodY as a key regulator

    • The precise role in metabolite transport may vary depending on species-specific metabolic pathways

Understanding these similarities and differences provides insight into the evolutionary conservation and adaptation of CidA proteins across diverse bacterial species.

What is known about the evolutionary conservation of cidA genes within the B. cereus group and other Gram-positive bacteria?

The evolutionary conservation of cidA genes reveals important patterns across bacterial species:

  • Within the B. cereus group:

    • The clhAB operon (containing cidA) is specific to the B. cereus group (B. cereus, B. thuringiensis, B. anthracis)

    • This suggests the operon was acquired or evolved before the divergence of these closely related species

    • Sequence conservation is high within this group, indicating functional importance

  • Broader distribution:

    • Cid/Lrg family proteins are well-conserved across Gram-positive bacteria

    • Homologs are found in both Gram-positive and Gram-negative bacteria, as well as in Archaea and plants

    • This wide distribution suggests an ancient origin and fundamental cellular role

  • Structural vs. functional conservation:

    Taxonomic GroupStructural ConservationFunctional ConservationRegulatory Conservation
    B. cereus groupHighHighHigh
    Other Bacillus spp.ModerateLikely moderateVariable
    Other Gram-positiveModerateModerateLow
    Gram-negativeLowUncertainLow

This evolutionary pattern suggests that while the core function of CidA as a holin-like protein is broadly conserved, specific regulatory mechanisms and physiological roles have diversified during bacterial evolution.

How does CidA contribute to B. cereus adaptation to different environmental conditions?

CidA plays a multifaceted role in B. cereus adaptation to environmental conditions:

  • Nutrient availability response:

    • The glucose-dependent regulation of cidA suggests it helps B. cereus adapt to carbohydrate-rich environments

    • The CodY-dependent regulation connects cidA expression to amino acid availability

    • Together, these regulatory mechanisms allow B. cereus to adjust cell morphology and division based on nutrient status

  • Stress tolerance mechanisms:

    • By modulating peptidoglycan hydrolase activity, CidA likely contributes to cell wall integrity during stress

    • The control of autolysis may prevent premature cell death under unfavorable conditions

    • Chain formation regulation could provide protection against environmental stressors

  • Growth phase transitions:

    • CidA's role in chain formation is particularly evident during late exponential and transition growth phases

    • This timing suggests CidA helps coordinate population-level responses to decreasing nutrient availability

    • The transition from exponential to stationary phase represents a critical adaptation point where CidA function is relevant

These adaptive functions highlight how CidA contributes to B. cereus survival and fitness across changing environmental conditions.

What role might CidA play in biofilm formation and persistence in B. cereus?

Based on evidence from related systems, CidA likely plays significant roles in B. cereus biofilm formation and persistence:

  • Contribution to biofilm architecture:

    • The control of cell chain length by CidA would directly influence biofilm structure

    • Longer chains in glucose-rich conditions may promote initial biofilm attachment and expansion

    • The altered cell morphology in ΔclhAB mutants would likely affect cell-cell interactions within biofilms

  • Programmed cell death in biofilm context:

    • In S. aureus, the CidR regulon (including cidA) is necessary for optimal biofilm development

    • Controlled cell lysis releases DNA that serves as a structural component of biofilms

    • By regulating autolysis, B. cereus CidA may similarly control extracellular DNA release in biofilms

  • Metabolic adaptations in biofilms:

    • Biofilms contain nutrient gradients where glucose may be limited in deeper layers

    • The glucose-responsive regulation of cidA would create heterogeneous expression within biofilms

    • This could contribute to the phenotypic heterogeneity characteristic of robust biofilms

These roles suggest that CidA represents a potential target for controlling biofilm formation in clinical and industrial contexts where B. cereus biofilms pose challenges.

What are the key challenges in expressing and purifying functional recombinant B. cereus CidA protein?

Researchers face several significant challenges when working with recombinant B. cereus CidA:

  • Membrane protein expression barriers:

    • As a transmembrane protein, CidA is inherently difficult to express at high levels

    • Toxicity to expression hosts due to membrane disruption

    • Protein misfolding and aggregation in heterologous expression systems

    • These issues often result in low yields of functional protein

  • Purification complications:

    • Requirement for detergents that maintain protein structure without disrupting function

    • Difficulty in removing detergent without causing aggregation

    • Potential loss of essential lipid interactions during purification

    • Challenge of maintaining oligomeric states that may be essential for function

  • Functional assessment limitations:

    • Difficulty in reconstituting membrane environment for functional assays

    • Challenges in distinguishing specific pore formation from non-specific membrane disruption

    • Need for specialized equipment to measure pore-forming activity

  • Recommended solutions:

    ChallengePotential Solution
    ToxicityUse tight expression control and specialized host strains
    MisfoldingLower expression temperature and optimize induction conditions
    Detergent selectionScreen multiple detergents using stability assays
    Functional reconstitutionUse liposome reconstitution with lipid compositions mimicking B. cereus membranes

Addressing these challenges requires specialized approaches and techniques developed specifically for membrane protein research.

What strategies can overcome the difficulties in studying the interaction between CidA and peptidoglycan hydrolases?

Investigating the interaction between CidA and peptidoglycan hydrolases presents unique challenges that can be addressed through several strategic approaches:

  • In vivo interaction studies:

    • Implement bacterial two-hybrid systems adapted for membrane proteins

    • Use fluorescence resonance energy transfer (FRET) with tagged proteins

    • Apply proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to CidA

    • These methods can detect interactions while proteins remain in their native membrane environment

  • Biochemical approaches:

    • Develop pull-down assays using detergent-solubilized membrane fractions

    • Apply chemical cross-linking followed by mass spectrometry identification

    • Use surface plasmon resonance with immobilized peptidoglycan hydrolases

    • These techniques can provide direct evidence of physical interactions

  • Genetic strategies:

    • Create suppressor mutation screens to identify compensatory mutations

    • Implement synthetic lethality approaches to identify functional relationships

    • Use transposon sequencing (Tn-seq) to map genetic interactions

    • These methods reveal functional connections even when physical interactions are transient

  • Structural biology integration:

    • Apply cryo-electron microscopy to visualize CidA-hydrolase complexes

    • Use hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Implement computational modeling based on partial structural data

    • These approaches can provide mechanistic insights into how the interactions occur

By combining these complementary strategies, researchers can overcome the inherent difficulties in studying membrane protein interactions and develop a comprehensive understanding of how CidA modulates peptidoglycan hydrolase activity.

What unexplored aspects of B. cereus CidA offer promising avenues for future research?

Several unexplored aspects of B. cereus CidA represent particularly promising research directions:

  • Structural characterization:

    • Determination of the three-dimensional structure of CidA

    • Investigation of oligomerization states and their functional significance

    • Identification of critical residues for pore formation

    • These structural insights would provide a foundation for understanding mechanism

  • Signaling pathways:

    • Exploration of how CidA activity may transduce signals about cell wall status

    • Investigation of potential post-translational modifications of CidA

    • Identification of additional regulatory factors beyond CodY and CcpA

    • These studies could reveal how CidA integrates into broader cellular signaling networks

  • Metabolic connections:

    • Detailed examination of the relationship between CidA and carbohydrate metabolism

    • Investigation of potential roles in pyruvate transport similar to S. aureus homologs

    • Exploration of connections to acetate metabolism and pH homeostasis

    • This research could uncover how CidA links metabolism to cell wall remodeling

  • Host-pathogen interactions:

    • Assessment of how CidA affects B. cereus virulence

    • Investigation of potential roles during infection and immune evasion

    • Examination of CidA as a potential target for antimicrobial development

    • These studies could reveal new aspects of B. cereus pathogenesis

These research directions would significantly advance our understanding of CidA function while potentially revealing new therapeutic targets.

How might systems biology approaches enhance our understanding of CidA's role in the B. cereus regulatory network?

Systems biology approaches offer powerful tools for elucidating CidA's position in the complex B. cereus regulatory network:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics in wildtype and ΔclhAB strains

    • Implement time-course studies across growth phases

    • Apply network analysis to identify regulatory hubs connected to CidA

    • This integration would reveal systemic effects of CidA activity

  • Computational modeling:

    • Develop mathematical models of CidA regulation incorporating CodY and CcpA pathways

    • Create cell wall synthesis/hydrolysis models that include CidA's modulatory role

    • Implement flux balance analysis to connect metabolic changes to CidA activity

    • These models could predict emergent behaviors and generate testable hypotheses

  • High-throughput phenotypic analysis:

    • Implement Phenotype MicroArrays to assess growth across hundreds of conditions

    • Use high-content imaging to quantify morphological effects at single-cell resolution

    • Apply machine learning to identify subtle phenotypic patterns

    • These approaches would comprehensively map CidA's phenotypic footprint

  • Synthetic biology applications:

    ApproachPotential Insight
    Promoter library screeningFine mapping of cidA regulation
    Chimeric protein constructionDomain function analysis
    Engineered regulatory circuitsTesting of regulatory network models
    CRISPR interferenceDose-dependent effects of cidA expression

By employing these systems approaches, researchers could develop a holistic understanding of how CidA functions within the broader context of B. cereus physiology, potentially revealing emergent properties not apparent from reductionist approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.