Recombinant Bacillus cereus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
mscL; BCB4264_A4785; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Bacillus cereus (strain B4264)
Target Names
mscL
Target Protein Sequence
MWNEFKKFAFKGNVVDLAVGVVIGAAFGKIVSSLVKDIITPLLGMVLGGVDFTSLHFGYG KSAVMYGNFIQTIFDFLIIAASIFMFVKVFNKLTSKKEEEKEEEIPEPTKEEELLGEIRD LLKQQNSSKDRA
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Bacillus cereus MscL and what is its physiological function?

The large conductance mechanosensitive channel (MscL) in Bacillus cereus is a membrane protein that forms a non-selective pore in response to increased membrane tension. This channel functions as an emergency release valve, protecting bacteria from osmotic stress by allowing rapid efflux of cytoplasmic solutes when cells experience hypoosmotic shock .

MscL has a pore diameter exceeding 25 Å, allowing passage of large organic ions and small proteins . With a conductance of approximately 10 nS, B. cereus MscL represents one of the largest channel conductances reported in cell membranes under quasi-physiological conditions . The channel opens in response to increased membrane tension, helping to protect bacteria from membrane damage during high turgor pressure by releasing cytoplasmic osmolytes .

How does the structure of Bacillus cereus MscL relate to its function?

While the specific structure of B. cereus MscL has not been fully resolved, insights from related bacterial MscL channels indicate a pentameric structure composed of:

  • An amphipathic helix (S1) at the N-terminus on the cytoplasmic side

  • Two transmembrane helices (TM1 and TM2) connected by a periplasmic loop

  • A cytosolic helix at the C-terminus

The pore is lined by TM1 from each subunit, with these helices tilted from the plane of the bilayer, giving MscL a pore that opens like a camera iris . This structural arrangement allows the channel to achieve its large conductance when open. The TM1 helix from each monomer contacts two other TM1 helices from adjacent monomers and two TM2 helices, creating a stable but dynamic structure that can respond to membrane tension .

Several complementary approaches are used to assess MscL function:

  • Patch-clamp electrophysiology: The gold standard for analyzing channel activity, allowing direct measurement of channel conductance, gating kinetics, and response to membrane tension. This technique has revealed that B. cereus MscL channels have a conductance of approximately 10 nS .

  • Liposome-based assays: MscL can be reconstituted into liposomes containing fluorescent dyes, allowing measurement of channel activity through dye release upon activation.

  • Osmotic shock survival assays: Comparing survival rates of wild-type and MscL-knockout strains after hypoosmotic shock provides insights into channel function in vivo. For example, MscL has been shown to increase sodium adaptation by regulating cell length in some bacteria .

  • Molecule uptake assays: MscL can facilitate uptake of membrane-impermeable molecules when activated, which can be monitored using fluorescently labeled molecules .

  • Antibiotic sensitivity testing: MscL's role in antibiotic resistance can be assessed by comparing MIC values between wild-type and MscL-deficient strains. Deletion of MscL has been shown to affect sensitivity to multiple antibiotics in some bacterial species .

How can site-directed mutagenesis be used to study B. cereus MscL gating mechanisms?

Site-directed mutagenesis offers powerful insights into MscL gating mechanisms. To implement this approach effectively:

  • Target specific residues based on structural models:

    • Residues in the pore constriction region (particularly in TM1)

    • Residues at the lipid-protein interface

    • Residues in the S1 domain that may interact with the cytoplasmic membrane

  • Introduce cysteine substitutions for chemical modification studies:

    • The L89C mutation has been particularly informative in related MscL studies

    • Modified cysteines can be labeled with MTSSL spin labels for EPR spectroscopy

    • Sulfhydryl modifications at key residues can stabilize specific channel conformations

  • Create tryptophan substitutions to probe hydrophobic interactions:

    • The L89W mutation has been shown to stabilize an expanded subconducting state

    • This suggests the importance of the TM pocket in channel gating

  • Employ charge substitutions to alter voltage sensitivity:

    • Introducing charged residues can enhance MscL's response to electric fields

    • This allows for triggered activation independent of membrane tension

  • Analyze mutants using complementary approaches:

    • Patch-clamp to assess changes in gating threshold, conductance, and kinetics

    • PELDOR spectroscopy to measure high-resolution distances during conformational changes

    • HDX-MS to identify regions with altered solvent accessibility

These mutational studies have revealed that in MscL channels, the TM pocket (occupied by lipid acyl chains) is critical for determining channel conformation, supporting the "lipid moves first" model of mechanosensation .

What factors influence the strain-specific variations in B. cereus MscL function?

B. cereus strains exhibit considerable variation in MscL function, which may be attributed to several factors:

  • Genetic polymorphisms within the MscL coding sequence:

    • Point mutations resulting in amino acid substitutions can alter channel properties

    • These variations may affect gating threshold, conductance, or ion selectivity

  • Differential expression levels:

    • Variations in promoter strength and regulatory elements

    • Environmental factors inducing different expression patterns

    • Growth phase-dependent expression differences

  • Membrane composition differences between strains:

    • Lipid bilayer thickness affects MscL pressure sensitivity

    • Membrane stiffness influences channel gating properties

    • Spontaneous curvature of lipid monolayers can alter MscL function

  • Interaction with strain-specific accessory proteins:

    • Cytoskeletal elements may modulate MscL activity

    • Regulatory proteins can affect channel localization or sensitivity

  • Flagellar co-expression:

    • Studies have shown correlation between swimming motility and MscL function

    • Strain-specific swimming motility correlates with the presence of flagella/flagellin

Research using polyclonal antisera and monoclonal antibodies against B. cereus flagellin proteins has demonstrated the relationship between strain-specific swimming motility and MscL function, with monoclonal antibody 1A11 (recognizing an epitope in the N-terminal region of flagellin) shown to inhibit bacterial swimming motility .

How can recombinant B. cereus MscL be effectively purified for structural and functional studies?

Purification of recombinant B. cereus MscL for high-quality structural and functional studies requires a systematic approach:

  • Optimal cell lysis strategy:

    • For E. coli expression systems, use a combination of lysozyme treatment (1 mg/mL, 30 min on ice) and sonication (6-8 cycles of 30s on/30s off)

    • Include protease inhibitors (PMSF, protease inhibitor cocktail) to prevent degradation

  • Membrane protein extraction:

    • Isolate membrane fraction by differential centrifugation (low-speed centrifugation to remove debris, ultracentrifugation at ≥100,000×g to pellet membranes)

    • Solubilize membranes with appropriate detergents (n-dodecyl-β-D-maltoside (DDM) at 1-2% is commonly effective)

  • Affinity chromatography:

    • For His-tagged constructs, use Ni-NTA resin with imidazole gradient elution (20-500 mM)

    • For strep-tagged proteins, use streptavidin columns with desthiobiotin elution

    • Consider tandem affinity tags for higher purity

  • Size exclusion chromatography:

    • Remove aggregates and isolate homogeneous protein

    • Assess oligomeric state (pentameric assemblies expected for MscL)

    • Buffer conditions: typically 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05-0.1% DDM

  • Quality control assessments:

    • SDS-PAGE to verify size and purity (expected size ~28 kDa for monomeric B. cereus MscL)

    • Western blotting with anti-MscL antibodies or tag-specific antibodies

    • Dynamic light scattering to assess homogeneity

    • Circular dichroism to confirm proper folding

A successful purification protocol for a recombinant B. cereus protein used a modified pET49b vector with BamHI and SalI restriction sites, followed by a three-step purification process yielding pure protein with high specific activity .

Researchers face several significant challenges when expressing functional B. cereus MscL in heterologous systems:

  • Membrane integration and proper folding:

    • MscL is a membrane protein requiring correct insertion into lipid bilayers

    • Heterologous systems may have different membrane composition affecting folding

    • Solution: Use of specialized E. coli strains engineered for membrane protein expression

  • Toxicity to host cells:

    • Expression of functional MscL can disrupt membrane integrity

    • Channel opening may cause leakage of cellular contents

    • Solution: Tight regulation of expression using inducible promoters; use of MscL mutants with higher gating threshold

  • Post-translational modifications:

    • Different bacterial systems may have varying post-translational modification capabilities

    • Solution: Select expression hosts with similar modification pathways or engineer the protein sequence to accommodate differences

  • Protein yield optimization:

    • Membrane proteins often express at lower levels than soluble proteins

    • Solution: Optimize growth conditions (temperature, media composition); screen multiple constructs with different fusion tags; consider codon optimization for the host organism

  • Functional assessment:

    • Confirming proper function of recombinant MscL requires specialized techniques

    • Solution: Integration of electrophysiological measurements, utilizing patch-clamp on reconstituted systems or whole cells expressing the recombinant channel

  • Protein stability during purification:

    • Membrane proteins can aggregate or denature during extraction from membranes

    • Solution: Screen multiple detergents for solubilization; include stabilizing agents; minimize time between extraction and reconstitution

Research has shown that PELDOR spectroscopy can be valuable for assessing the correct folding of MscL when expressed in new strains designed for efficient membrane protein expression, providing a tool to address these challenges .

How can molecular insights into B. cereus MscL be leveraged for antimicrobial development?

The unique properties of B. cereus MscL offer several promising avenues for antimicrobial development:

  • MscL as a direct antimicrobial target:

    • Compounds that lock MscL in an open state could cause cytoplasmic leakage

    • Several agonists bind directly to MscL at the interface between S1 and TM1 of one subunit with TM2 of another subunit

    • These binding sites are close to the TM pocket, potentially disrupting protein-lipid interactions crucial for channel gating

  • MscL-mediated drug delivery:

    • MscL's large pore (>25 Å) allows passage of large molecules, enabling delivery of antibiotics that normally cannot penetrate bacterial membranes

    • Engineered MscL variants with altered gating properties can be triggered to open using non-mechanical stimuli

    • This approach could revitalize existing antibiotics by overcoming permeability barriers

  • Species-specific targeting:

    • Despite high conservation, B. cereus MscL shows species-specific structural features

    • Compounds like ramizol have been identified through in silico screening as MscL interactors that inhibit growth of MscL-expressing bacteria

    • Ramizol reduced the gating threshold of MscL in patch-clamp electrophysiology and has advanced to pre-clinical studies

  • Exploiting MscL's role in stress response:

    • B. cereus MscL is critical for osmotic adaptation

    • Compounds that interfere with osmotic regulation through MscL could be effective in specific environments

    • Targeting MscL may enhance susceptibility to osmotic shock-based treatments

  • Combination therapy approaches:

    • MscL influences sensitivity to multiple antibiotics, including chloramphenicol, erythromycin, penicillin, and oxacillin

    • Pharmacological modulation of MscL could potentially increase effectiveness of existing antibiotics

    • Specific mutations in MscL could serve as markers for predicting antibiotic responsiveness

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.