Recombinant Bacillus cereus Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus cereus Lipoprotein Signal Peptidase (lspA)

Recombinant Bacillus cereus lipoprotein signal peptidase, commonly referred to as lspA, is a crucial enzyme involved in the processing of lipoproteins in bacteria. This enzyme is part of the signal peptidase II family and plays a significant role in the maturation of lipoproteins by cleaving the signal peptides from prolipoproteins, which is essential for their proper localization and function within the bacterial membrane.

Function and Mechanism

Role in Lipoprotein Processing

LspA specifically catalyzes the removal of signal peptides from prolipoproteins, facilitating their anchoring to the bacterial membrane. This process is vital for the functionality of lipoproteins, which serve various roles including enzymatic activity, structural functions, and involvement in virulence mechanisms. The enzyme operates through an aspartyl protease mechanism, which is characteristic of this class of enzymes.

Importance in Bacterial Physiology

The processing of lipoproteins by lspA is critical for bacterial viability and pathogenicity. Research indicates that lipoprotein processing is necessary for cellular homeostasis and growth under various environmental conditions, including temperature fluctuations . Disruption of lspA function can lead to accumulation of unprocessed prolipoproteins, adversely affecting bacterial growth and virulence.

Recombinant Production

Expression Systems

Recombinant lspA has been successfully expressed in Escherichia coli, allowing for large-scale production of the enzyme for research purposes. The recombinant protein typically includes an N-terminal His-tag for purification purposes .

Purification and Characterization

The purification process generally involves affinity chromatography followed by size-exclusion chromatography to ensure high purity levels (greater than 90% as determined by SDS-PAGE). The recombinant protein is usually stored as a lyophilized powder to maintain stability .

Research Findings

Studies on Functionality

Extensive research has demonstrated that lspA is not only essential for lipoprotein maturation but also plays a role in bacterial pathogenicity. For instance, studies indicate that mutations or disruptions in lspA can lead to decreased virulence in Bacillus cereus, highlighting its importance in host-pathogen interactions .

Comparative Studies

Comparative studies among various Bacillus species have shown that while lspA is conserved across different strains, variations exist that may influence its activity and substrate specificity . This conservation underscores the evolutionary significance of lipoprotein processing mechanisms in bacteria.

Data Table

FeatureDescription
Gene NameLipoprotein signal peptidase (lspA)
OrganismBacillus cereus
Protein Length202 amino acids
Expression SystemEscherichia coli
Purity Level>90% (SDS-PAGE)
Storage Conditions-20°C/-80°C; avoid repeated freeze-thaw cycles

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; BCG9842_B1247; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-152
Protein Length
full length protein
Species
Bacillus cereus (strain G9842)
Target Names
lspA
Target Protein Sequence
MIYYVIALFVIAIDQISKWLIVKNMELGTSIPIIDNVLYITSHRNRGAAWGILENKMWFF YIITVVFVVFIVFYMKKYAKTDKLLGISLGLILGGAIGNFIDRVFRQEVVDFIHVYIFSY NYPVFNIADSALCIGVVLIIIQTLLEGKKAKE
Uniprot No.

Target Background

Function
This protein is a specific catalyst for the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (lspA) in Bacillus cereus and what is its functional significance?

Lipoprotein signal peptidase (lspA), also known as Signal peptidase II (SPase II), is an essential enzyme in gram-positive bacteria including Bacillus cereus. It plays a critical role in the processing of prolipoproteins by cleaving signal peptides from lipid-modified prolipoproteins. The enzyme is classified as an unusual aspartic acid protease with EC number 3.4.23.36 .

In B. cereus (strain AH187), lspA is a membrane-bound protein comprising 152 amino acids with several conserved functional domains essential for its catalytic activity. Sequence alignment studies show conserved Asn, Asp, and Ala residues in boxes C and D that are critical for the catalytic activity of bacterial LspA .

The functional significance of lspA includes:

  • Essential role in the bacterial lipoprotein processing pathway

  • Involvement in bacterial pathogenicity mechanisms

  • Contribution to cell envelope integrity and stability

  • Potential target for antimicrobial development due to its absence in human cells

What are the recommended protocols for cloning and expressing recombinant B. cereus lspA in E. coli?

Based on successful expression strategies documented in the literature, the following protocol is recommended:

Cloning Strategy:

  • Amplify the complete lspA ORF (~450-500 bp) from B. cereus genomic DNA using PCR with specific primers containing appropriate restriction sites (e.g., BamHI and EcoRI)

  • Clone the amplified fragment into an expression vector with an inducible promoter (e.g., pTrcHis vector system with N-terminal His-tag under trc promoter control)

  • Transform the constructed plasmid into a suitable E. coli host strain (e.g., E. coli Top10 or BL21)

Expression Conditions:

  • Culture transformed E. coli in LB media with appropriate antibiotic selection

  • Induce protein expression when culture reaches mid-log phase (OD600 0.6-0.8)

  • For temperature-inducible systems, shift culture temperature from 30°C to 37-41°C

  • Harvest cells 3-6 hours post-induction

This approach has been demonstrated to yield functional recombinant lspA as confirmed by Western blot analysis using anti-His antibodies and functional assays such as globomycin resistance tests .

How can I design experiments to measure the functional activity of recombinant B. cereus lspA?

Two complementary approaches are recommended for assessing functional activity:

1. Globomycin Resistance Assay:

  • Principle: Globomycin is a cyclic peptide antibiotic that inhibits SPase II activity, leading to growth inhibition in gram-negative bacteria. Overexpression of functional lspA confers increased globomycin resistance.

  • Protocol:

    • Transform E. coli with recombinant plasmid expressing B. cereus lspA

    • Grow transformed cells in media containing increasing concentrations of globomycin (12.5-200 μg/ml)

    • Measure bacterial growth at different time points

    • Compare growth with positive control (E. coli lspA) and negative control (empty vector)

    • Statistical significance can be assessed using Student's t-test (p<0.05)

2. Genetic Complementation Assay:

  • Principle: Functional complementation of temperature-sensitive E. coli lspA mutant (e.g., E. coli Y815) at non-permissive temperature.

  • Protocol:

    • Transform temperature-sensitive E. coli Y815 with recombinant plasmid expressing B. cereus lspA

    • Grow transformed cells at permissive (30°C) and non-permissive (42°C) temperatures

    • Measure growth restoration at non-permissive temperature compared to controls

    • Calculate complementation efficiency

Both assays provide strong evidence for functional activity when positive results are observed, though genetic complementation often shows lower efficiency with heterologous proteins despite conserved functional domains.

What experimental design is most suitable for analyzing differential expression of lspA during bacterial growth phases?

A robust experimental design for analyzing differential lspA expression should include time-course sampling across multiple growth phases. Based on previous research methodologies, the following design is recommended:

Experimental Design:

  • Establish synchronized bacterial cultures

  • Collect samples at critical time points:

    • Pre-infection (for pathogenic studies)

    • Early log phase (2-4 hours post-inoculation)

    • Mid-log phase (8 hours post-inoculation)

    • Late log phase (24 hours post-inoculation)

    • Stationary phase (48 hours post-inoculation)

    • Late stationary/death phase (120 hours post-inoculation)

  • Extract total RNA from samples using RNAprotect reagent

  • Perform two-step real-time quantitative RT-PCR

  • Include reference genes for normalization

  • Compare expression patterns with related genes (e.g., lgt, lepB)

Data Collection Table:

Time PointRelative Expression (lspA)Relative Expression (lgt)Relative Expression (lepB)Cell Density (OD600)
0h (pre-infection)
2h
8h
24h
48h
120h

In previous studies, this approach revealed that lspA and lgt (involved in lipoprotein secretion) show similar expression patterns, while lepB (involved in non-lipoprotein secretion) exhibits higher expression levels, suggesting it serves as the major signal peptidase for protein secretion .

How does lspA functionality relate to B. cereus pathogenicity and virulence mechanisms?

The relationship between lspA and B. cereus pathogenicity is multifaceted:

  • Lipoprotein Processing: As demonstrated in related bacterial species, lspA is critical for processing lipoproteins that contribute to bacterial virulence. In B. cereus, properly processed lipoproteins are essential for:

    • Cell envelope integrity

    • Nutrient acquisition

    • Host cell adhesion

    • Immune evasion mechanisms

  • Virulence Factor Expression: In silico prediction from the B. cereus genome identified 89 secretory proteins with putative signal peptide sequences, of which 14 are lipoproteins requiring lspA processing. These lipoproteins may include virulence factors that contribute to pathogenicity

  • Toxin Production Connection: While not directly responsible for toxin production, lspA-processed lipoproteins may be involved in regulatory networks affecting toxin synthesis or secretion. B. cereus produces several toxins, including cereulide (encoded by the ces gene cluster) and regulated by NRPS systems

  • Differential Expression During Infection: Transcription analysis shows that lspA expression varies during different growth phases, with higher levels at the pre-infection stage, suggesting its importance in preparing the bacterium for infection and host cell interaction

What is the relationship between lspA function and antimicrobial resistance mechanisms in B. cereus?

The relationship between lspA and antimicrobial resistance is an emerging area of research with several important considerations:

  • Globomycin Resistance: Functional lspA confers resistance to globomycin, a cyclic peptide antibiotic that specifically inhibits SPase II. Overexpression of functional lspA from B. cereus in E. coli increases globomycin resistance, as measured by growth in the presence of increasing concentrations (25 μg/ml to 200 μg/ml) of the antibiotic

  • Cell Envelope Integrity: Proper lipoprotein processing by lspA is essential for maintaining cell envelope integrity. Compromised cell envelope can increase susceptibility to various antimicrobials that target the cell wall or membrane

  • Cross-resistance Mechanisms: While not directly involved in established resistance mechanisms like efflux pumps or target modifications, lspA-processed lipoproteins may contribute to stress responses that enhance bacterial survival under antimicrobial challenge

  • Potential Drug Target: The essentiality of lspA function for bacterial viability makes it a potential target for novel antimicrobial development. Inhibition of lspA could disrupt proper lipoprotein processing, leading to cell envelope defects and bacterial death

Research using temperature-sensitive mutants and genetic complementation assays demonstrates that functional lspA activity is essential for bacterial growth under challenging conditions, suggesting its role in adaptive responses that may indirectly contribute to antimicrobial tolerance .

Why might recombinant B. cereus lspA show lower functional activity in heterologous systems compared to native conditions?

Several factors may contribute to reduced functional activity of recombinant B. cereus lspA in heterologous systems:

This phenomenon has been observed in genetic complementation experiments where recombinant B. cereus lspA restored growth of temperature-sensitive E. coli strain Y815 at non-permissive temperature at approximately one-fifth the rate of E. coli lspA, despite showing similar levels of globomycin resistance .

What are the critical parameters to optimize when designing experiments to express and purify functional recombinant lspA?

Based on successful recombinant protein expression strategies from B. cereus and related organisms, the following parameters should be optimized:

Expression System Optimization:

  • Vector Selection: Choose vectors with appropriate promoters for controlled expression. Temperature-induced systems like pIET98 with runaway replication or IPTG-inducible trc promoters (pTrcHis) have shown success

  • Host Strain Selection: E. coli BL21 derivatives often provide better expression of prokaryotic membrane proteins. Consider strains with reduced protease activity

  • Growth Conditions:

    • Media composition: Semi-synthetic high-cell density media may yield better results

    • Growth temperature: 30°C pre-induction, 37-41°C post-induction

    • Induction point: Mid-log phase (OD600 0.6-0.8)

    • Dissolved oxygen: Maintain above 10% saturation

Purification Strategy:

  • Membrane Protein Solubilization: Use appropriate detergents (DDM, LDAO, or FC-12) for membrane protein extraction

  • Purification Steps:

    • Heat denaturation (if the target protein is thermostable)

    • Liquid-liquid extraction

    • Affinity chromatography (if tagged)

    • Gel filtration

    • Ion-exchange chromatography

Activity Preservation:

  • Buffer Composition: Tris-based buffer with 50% glycerol has been shown to preserve activity

  • Storage Conditions: Store at -20°C or -80°C for extended storage

  • Aliquoting: Prepare small working aliquots to avoid repeated freeze-thaw cycles

  • Working Stocks: Store at 4°C for up to one week

Successful optimization has been reported to yield recombinant enzymes constituting up to 30% of soluble cell protein with specific activities of over 100 U/mg in similar B. cereus enzymes .

What bioinformatic approaches can be used to predict lipoproteins processed by lspA in B. cereus?

Several complementary bioinformatic tools and approaches can effectively predict lipoproteins processed by lspA in B. cereus:

  • Signal Peptide Prediction Tools:

    • SignalP (version 3.0 or later) using both neural network and hidden Markov model algorithms

    • LipoP (version 1.0 or later) specifically designed to identify lipoproteins

    • Phobius for integrated prediction of transmembrane topology and signal peptides

  • Lipobox Motif Identification:

    • Search for the conserved lipobox motif [LVI][ASTVI][GAS][C] where the cysteine residue becomes the N-terminal amino acid of the mature lipoprotein after signal peptide cleavage

    • Position-specific scoring matrices can improve detection accuracy

  • Whole Genome Analysis Pipeline:

    • Analyze complete genome sequence (for B. cereus strain AH187 or similar strains)

    • Identify all open reading frames (ORFs)

    • Apply signal peptide and lipoprotein prediction algorithms

    • Filter results based on prediction confidence scores

Previous analysis of the R. typhi genome (with 838 annotated ORFs) identified 89 secretory proteins with putative signal peptide sequences, of which 14 were recognized as putative lipoproteins. Similar proportions might be expected in B. cereus .

How do I resolve contradictory results in lspA functional studies between different experimental approaches?

When facing contradictory results in lspA functional studies, consider the following systematic troubleshooting approach:

  • Understand Assay Principles:

    • Globomycin resistance assays measure SPase II-globomycin interaction

    • Genetic complementation assays measure prolipoprotein processing

    • These are independent activities despite involving the same enzyme

  • Reconciliation Strategies:

    • Functional Domain Analysis: Map mutations or variations to functional domains to understand their impact on different activities

    • Substrate Specificity Assessment: Different substrates may be processed with varying efficiencies

    • Environmental Condition Evaluation: Temperature, pH, and ionic conditions can affect different aspects of enzyme function differently

  • Methodological Cross-Validation:

    • Perform multiple independent assays (e.g., globomycin resistance, genetic complementation, direct enzymatic activity)

    • Use positive controls (e.g., E. coli lspA) and negative controls (inactive mutants)

    • Quantify activity levels under standardized conditions

  • Statistical Analysis:

    • Apply appropriate statistical tests (e.g., Student's t-test) to determine if differences are significant

    • Consider using factorial experimental designs to systematically evaluate parameter interactions

In previous studies, seemingly contradictory results between globomycin resistance (where B. cereus lspA performed similarly to E. coli lspA) and genetic complementation (where B. cereus lspA showed lower activity) were reconciled by recognizing that these assays measure different aspects of enzyme function .

What experimental design approaches provide the most robust data for comparing lspA function across different bacterial species?

To generate robust comparative data on lspA function across bacterial species, consider implementing the following experimental design strategies:

  • Factorial Design with Controlled Variables:

    • Include multiple lspA homologs (B. cereus, E. coli, other relevant species)

    • Express under identical conditions (same vector, host, induction protocol)

    • Test across multiple functional assays

    • Use a minimum of three biological replicates and three technical replicates

Sample Factorial Design Table:

Factor A: Species originFactor B: Assay typeFactor C: Growth condition
B. cereus lspAGlobomycin resistance30°C
E. coli lspAGenetic complementation37°C
R. typhi lspADirect enzymatic assay42°C
  • Standardized Assay Conditions:

    • Develop a standard set of assay conditions applicable across all species variants

    • Include internal controls for normalization

    • Use defined substrates with known kinetic parameters

  • Chimeric Protein Approach:

    • Create domain-swapped chimeras between lspA proteins from different species

    • Map functional differences to specific protein regions

    • Correlate with sequence and structural differences

  • Integrated Multi-omics Analysis:

    • Combine functional assays with structural analysis, transcriptomics, and proteomics

    • Correlate functional differences with expression patterns and protein-protein interactions

    • Consider the entire lipoprotein processing pathway context

What emerging applications might exploit recombinant B. cereus lspA in biotechnology or medicine?

Several promising applications for recombinant B. cereus lspA are emerging:

  • Antimicrobial Drug Development:

    • Target validation studies using recombinant lspA

    • High-throughput screening for novel SPase II inhibitors

    • Structure-based drug design for species-specific inhibitors

    • Development of combination therapies targeting different steps in lipoprotein processing

  • Diagnostic Applications:

    • Development of antibody-based detection systems for B. cereus

    • Species-specific lspA detection in food safety applications

    • Differentiation between pathogenic and non-pathogenic B. cereus strains

  • Biotechnological Applications:

    • Designer lipoprotein processing systems for biotechnology

    • Surface display technologies utilizing lipoprotein anchoring

    • Engineered bacteria with modified lipoproteins for various applications

  • Fundamental Research Tools:

    • Structure-function relationship studies

    • Bacterial cell envelope assembly investigations

    • Evolutionary studies of essential bacterial processes

The specific biochemical properties of B. cereus lspA, including its thermal stability and activity across varied pH conditions, make it particularly suitable for biotechnological applications requiring robust enzymatic activity .

How can gene editing technologies be applied to study lspA function in B. cereus?

Modern gene editing technologies offer powerful approaches to investigate lspA function in B. cereus:

  • CRISPR-Cas9 Applications:

    • Generation of conditional knockdown mutants (since complete knockout may be lethal)

    • Introduction of point mutations to study structure-function relationships

    • Domain swapping with homologs from other species

    • Promoter modifications to control expression levels

  • Site-Directed Mutagenesis Strategy:

    • Target highly conserved residues (Asn, Asp, Ala in boxes C and D)

    • Create tagged versions for localization studies

    • Engineer thermosensitive variants for conditional studies

  • Reporter Fusion Constructs:

    • Create lspA-reporter gene fusions to monitor expression patterns

    • Develop fluorescent protein fusions to study subcellular localization

    • Design split reporter systems to investigate protein-protein interactions

  • Inducible Expression Systems:

    • Implement temperature-sensitive or chemical-inducible promoters

    • Create depletion strains to study the effects of lspA insufficiency

    • Develop overexpression systems to identify dosage effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.