Recombinant Bacillus cereus NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; BCE33L5000; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Bacillus cereus (strain ZK / E33L)
Target Names
nuoA
Target Protein Sequence
MASVYENSYMIVLIFLLLGILLPVVALTLGRMLRPNKPSAAKATTYESGIEPFHDANIRF HARYYIFALLFVIFDVETLFLYPWAVAYDNLGLFALIEMLIFVVMLLVGLAYAWKKKVLQ WL
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, the primary electron acceptor is believed to be menaquinone. This process couples redox reactions with proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thereby conserving energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit A in Bacillus cereus metabolism?

NADH-quinone oxidoreductase (Complex I) plays a critical role in the electron transport chain of B. cereus, facilitating the transfer of electrons from NADH to quinones and contributing to the establishment of a proton gradient for ATP synthesis. The subunit A (nuoA) is involved in the membrane-embedded domain of this complex, which is particularly important during aerobic respiration. In B. cereus, this enzyme is part of the redox homeostasis system that influences both growth and virulence factor production. The enzyme's activity directly affects the NAD+/NADH ratio, which has been shown to significantly impact antibacterial peptide production and pathogenicity .

What genomic and structural features characterize the nuoA gene in Bacillus cereus?

The nuoA gene in B. cereus encodes a hydrophobic membrane protein that constitutes one of the 14 subunits of the NADH-quinone oxidoreductase complex. It is typically arranged in an operon with other nuo genes, though the exact arrangement may vary between B. cereus strains. The protein contains transmembrane helices that anchor it within the cytoplasmic membrane. Sequence analysis reveals conserved regions critical for interaction with other Nuo subunits and for proper assembly of the functional complex. Mutations in these conserved regions can significantly alter the efficiency of electron transport, impacting cellular energetics and downstream metabolic processes that influence both growth characteristics and virulence factor production .

What are the optimal conditions for cloning and expressing recombinant B. cereus nuoA?

For effective cloning and expression of recombinant B. cereus nuoA, researchers should consider the following methodological approach:

  • Vector Selection: pET expression systems with T7 promoters provide good control over expression. For membrane proteins like nuoA, vectors with fusion tags that aid solubility (such as MBP or SUMO) are recommended.

  • Host Selection: E. coli BL21(DE3) derivatives, particularly C41(DE3) or C43(DE3), are optimized for membrane protein expression. For native-like conditions, Bacillus subtilis expression systems can be considered.

  • Expression Conditions:

    • Induction at lower temperatures (16-20°C)

    • Lower IPTG concentrations (0.1-0.5 mM)

    • Extended expression time (16-24 hours)

    • Supplementation with membrane-stabilizing agents

  • Codon Optimization: Adjust codons to match the preferred usage in the expression host to improve translation efficiency.

Similar approaches have proven successful in expressing other membrane proteins from B. cereus, such as glucose dehydrogenase, which was effectively overexpressed to enhance antibacterial activity .

What purification strategies yield the highest activity for recombinant nuoA protein?

Purifying recombinant nuoA protein while maintaining its activity requires specialized approaches due to its membrane-associated nature:

  • Membrane Extraction:

    • Cell disruption by sonication or French press

    • Membrane fraction isolation through differential centrifugation

    • Selective solubilization using mild detergents (DDM, LDAO, or Triton X-100)

  • Chromatography Sequence:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) with detergent in all buffers

    • Intermediate: Ion exchange chromatography for removing contaminants

    • Final: Size exclusion chromatography for obtaining homogeneous protein

  • Activity Preservation:

    • Inclusion of phospholipids during purification

    • Maintaining appropriate detergent-to-protein ratios

    • Addition of glycerol (10-20%) to stabilize the protein

    • Inclusion of reducing agents to prevent oxidation of critical thiols

  • Quality Assessment:

    • Native PAGE to verify complex formation

    • Spectroscopic analysis to confirm cofactor binding

    • Activity assays measuring NADH oxidation rates

These approaches parallel successful strategies used for similar B. cereus membrane proteins, where enzymatic activity was carefully preserved throughout purification processes .

How can researchers reliably measure nuoA activity in physiologically relevant conditions?

Reliable measurement of nuoA activity in physiologically relevant conditions involves:

  • Spectrophotometric Assays:

    • Monitor NADH oxidation at 340 nm in the presence of quinone analogs

    • Use reaction buffers that mimic B. cereus cytoplasmic conditions (pH 7.0-7.5)

    • Include physiological concentrations of ions (K+, Mg2+)

  • Oxygen Consumption Measurements:

    • Employ oxygen electrodes to measure respiratory activity

    • Assess inhibitor sensitivity using rotenone or piericidin A

    • Correlate oxygen consumption with NADH oxidation rates

  • Redox State Analysis:

    • Quantify intracellular NAD+/NADH ratios as indicators of nuoA function

    • Use fluorescent NAD(P)H sensors for real-time monitoring

  • Membrane Potential Measurements:

    • Utilize fluorescent dyes (DiSC3(5), JC-1) to assess proton translocation

    • Measure proton-motive force generation as an indicator of activity

When assessing nuoA function in intact B. cereus cells, researchers should consider the metabolic state of the bacteria, as the NAD+/NADH ratio significantly impacts various cellular processes, including antimicrobial peptide production. As demonstrated in recent studies with B. cereus 0-9, the intracellular NADH/NAD+ ratio directly correlates with antibacterial activity, suggesting similar relationships may exist with nuoA function .

How does nuoA contribute to B. cereus adaptation to environmental stressors?

The nuoA subunit plays a sophisticated role in B. cereus adaptation to environmental stressors through several mechanisms:

  • Oxygen Fluctuation Response:

    • During transitions between aerobic and anaerobic conditions, nuoA expression is dynamically regulated

    • Under oxygen limitation, the bacterium modifies electron transport chain components, including nuoA, to optimize energy conservation

    • This adaptation is crucial for B. cereus survival in the fluctuating oxygen environments of the human gastrointestinal tract

  • pH Stress Management:

    • nuoA participates in maintaining proton homeostasis during acid stress

    • The proton translocation function of Complex I contributes to pH tolerance

    • This adaptation helps B. cereus survive gastric passage and establish infection

  • Redox Balance Maintenance:

    • Under stress conditions, nuoA contributes to NAD+/NADH ratio regulation

    • This ratio influences the expression of virulence factors and stress response proteins

    • Metabolic flexibility enabled by proper redox balance allows adaptation to diverse environments

  • Energy Conservation During Stress:

    • nuoA activity adjusts to optimize ATP production under resource limitation

    • This energy management is critical for expressing stress-response proteins

What is the relationship between nuoA activity and virulence factor production in B. cereus?

The relationship between nuoA activity and virulence factor production in B. cereus involves intricate metabolic connections:

NAD+/NADH RationuoA ActivityMetabolic StateVirulence Factor ProductionPathogenicity
HighIncreasedOxidativeEnhanced enterotoxin expressionIncreased
LowDecreasedReductiveRepressed enterotoxin expressionDecreased
FluctuatingDynamicTransitionalTemporally regulated expressionContext-dependent
  • Redox-Dependent Regulation:

    • nuoA activity directly affects the cellular redox state by influencing NAD+/NADH ratios

    • Enterotoxin production in B. cereus is redox-sensitive and peaks under specific NAD+/NADH conditions

    • Transcriptional regulators sensing the redox state modulate virulence gene expression

  • Metabolic Pathway Integration:

    • nuoA function affects carbon flux through central metabolism

    • Metabolic intermediates serve as signals for virulence regulation

    • Fermentation by-products can influence enterotoxin production

  • Energy Availability Impact:

    • Efficient nuoA function provides energy (ATP) required for toxin synthesis

    • Energy limitation can trigger stress responses that alter virulence expression

  • Temporal Coordination:

    • nuoA activity fluctuations throughout growth phases align with toxin production patterns

    • This coordination ensures optimal resource allocation between growth and virulence

This relationship explains why alterations in B. cereus metabolism, including changes to NAD(P)+ metabolic cycling, directly impact antimicrobial peptide synthesis and pathogenicity .

How do mutations in nuoA affect B. cereus fitness across different ecological niches?

Mutations in nuoA have complex effects on B. cereus fitness across different ecological niches due to the protein's central role in energy metabolism:

  • Soil Environment:

    • Mutations affecting proton translocation efficiency may provide advantages in acidic soils

    • Variants with altered substrate specificity might better utilize soil-specific electron donors

    • The adaptability to fluctuating oxygen levels in soil micropockets may be enhanced in certain mutants

  • Food Matrices:

    • Mutations improving function at refrigeration temperatures could enable better cold growth

    • Variants with altered inhibitor sensitivity might resist certain food preservatives

    • Energy efficiency mutations could provide competitive advantages in nutrient-limited foods

  • Mammalian Host:

    • Mutations affecting proton translocation may alter survival in acidic stomach conditions

    • Variants with modified activity under oxygen limitation could enhance intestinal colonization

    • Alterations affecting redox balancing may impact enterotoxin production and pathogenicity

  • Competitive Microbial Communities:

    • Some mutations might enhance energy efficiency for better competition

    • Variants could alter the production of antimicrobial compounds that inhibit competing microbes

    • Mutations affecting stress response coordination may impact community persistence

Research on B. cereus strains with modified glucose dehydrogenase activity demonstrates how enzyme modifications can dramatically alter strain fitness and antibacterial activity, suggesting similar impacts would be observed with nuoA mutations .

What are the most common challenges in expressing functional recombinant nuoA and how can they be addressed?

Researchers commonly encounter several challenges when expressing functional recombinant nuoA, with effective solutions for each:

  • Protein Misfolding and Aggregation:

    • Challenge: Hydrophobic membrane proteins like nuoA often aggregate during expression

    • Solution: Express at lower temperatures (16-20°C), use specialized strains (C41/C43), and include membrane-mimicking environments (detergents or amphipols)

  • Poor Expression Levels:

    • Challenge: Membrane proteins typically express at lower levels than soluble proteins

    • Solution: Optimize codon usage, use strong inducible promoters, and test expression in B. subtilis as an alternative host

  • Loss of Activity During Purification:

    • Challenge: Detergent extraction can disrupt protein-lipid interactions essential for activity

    • Solution: Screen multiple detergents, include phospholipids during purification, and assess activity at each purification step

  • Incomplete Complex Assembly:

    • Challenge: nuoA typically functions as part of a multi-subunit complex

    • Solution: Consider co-expression of interacting subunits or reconstitution approaches with purified components

  • Unstable Protein:

    • Challenge: Rapid degradation after purification

    • Solution: Include protease inhibitors, optimize buffer conditions, and consider nanodiscs or liposome reconstitution for stability

These approaches parallel solutions developed for other challenging B. cereus membrane proteins, such as the enzyme modifications that successfully enhanced glucose dehydrogenase stability and catalytic efficiency .

How can researchers distinguish between direct effects of nuoA manipulation and indirect metabolic consequences?

Distinguishing direct effects of nuoA manipulation from indirect metabolic consequences requires a systematic approach:

  • Complementation Studies:

    • Generate clean nuoA deletion mutants

    • Construct complementation strains with wild-type and variant nuoA

    • Compare phenotypes across wild-type, deletion, and complemented strains

  • Real-Time Metabolic Monitoring:

    • Employ metabolic flux analysis to track carbon flow changes

    • Measure NAD+/NADH ratios in real-time using fluorescent sensors

    • Quantify ATP/ADP ratios to assess energetic consequences

  • Temporal Resolution Studies:

    • Use time-course experiments to determine primary (rapid) versus secondary (delayed) effects

    • Apply inhibitors that target specific metabolic nodes to isolate pathways

    • Utilize inducible expression systems for controlled nuoA activation

  • Multi-Omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics

    • Construct metabolic models to predict system-wide effects

    • Validate predictions with targeted biochemical assays

  • Synthetic Biology Approaches:

    • Replace native nuoA with orthologous proteins from related species

    • Engineer variants with specific functional alterations

    • Create reporter strains that respond to relevant metabolic changes

These approaches enable researchers to differentiate between direct nuoA functions and the cascade of metabolic adaptations that follow, similar to the systematic approach used in recent B. cereus glucose dehydrogenase studies where specific mutations produced defined changes in catalytic efficiency and antibacterial activity .

What technical limitations exist in studying nuoA interactions with other respiratory chain components?

Studying nuoA interactions with other respiratory chain components presents several technical limitations that researchers must address:

  • Membrane Protein Complex Stability:

    • Limitation: Respiratory complexes often dissociate during extraction

    • Approach: Use mild solubilization conditions, crosslinking techniques, and native electrophoresis to preserve interactions

  • Dynamic Nature of Interactions:

    • Limitation: Respiratory chain components form dynamic supercomplexes that change with conditions

    • Approach: Employ real-time imaging techniques, FRET-based interaction assays, and condition-specific crosslinking

  • Reconstitution Challenges:

    • Limitation: Recreating functional interactions in vitro is technically demanding

    • Approach: Develop liposome reconstitution systems with defined lipid compositions that mimic the B. cereus membrane

  • Specificity Verification:

    • Limitation: Differentiating specific from non-specific interactions

    • Approach: Use multiple complementary techniques (co-immunoprecipitation, bacterial two-hybrid, proximity labeling)

  • Quantitative Assessment:

    • Limitation: Measuring interaction strength under physiological conditions

    • Approach: Apply microscale thermophoresis, surface plasmon resonance with detergent-solubilized proteins, or nanodisc-embedded complexes

  • Structural Characterization:

    • Limitation: Obtaining structural data on membrane protein complexes

    • Approach: Utilize cryo-electron microscopy, which has revolutionized membrane protein complex structure determination

Researchers can draw from successful approaches used in studying other B. cereus membrane proteins, where techniques like Root Mean Square Fluctuation analysis from molecular dynamics revealed critical conformational changes affecting protein function .

What statistical approaches are most appropriate for analyzing nuoA mutant phenotypes?

When analyzing nuoA mutant phenotypes, researchers should select statistical approaches based on the experimental design and data characteristics:

  • Comparing Growth Parameters:

    • ANOVA with post-hoc tests for comparing multiple strains

    • Mixed-effects models for time-course growth data

    • Nonlinear regression for fitting growth curves and extracting parameters

  • Enzyme Activity Comparisons:

    • Student's t-test or Mann-Whitney U test for pairwise comparisons

    • ANCOVA when controlling for cofactor concentrations or pH

    • Michaelis-Menten kinetic parameter analysis with confidence intervals

  • Virulence Factor Production:

    • Multiple regression to correlate enzymatic activity with toxin production

    • Principal component analysis to identify patterns across multiple virulence factors

    • Time-series analysis for temporal expression patterns

  • Multivariate Phenotypic Analysis:

    • Hierarchical clustering to group similar mutants

    • Discriminant analysis to identify variables that best distinguish mutant classes

    • Machine learning approaches for complex phenotypic predictions

  • Reproducibility Assessment:

    • Calculate coefficients of variation across replicates

    • Bayesian approaches to incorporate prior knowledge

    • Power analysis to determine adequate sample sizes

When analyzing enzyme kinetics data, approaches similar to those used in recent B. cereus glucose dehydrogenase studies would be appropriate, where specific activity and Kcat/Km values were calculated to precisely quantify improvements in catalytic efficiency .

How should researchers interpret apparently contradictory results between in vitro nuoA activity and in vivo phenotypes?

When faced with contradictory results between in vitro nuoA activity and in vivo phenotypes, researchers should consider:

  • Regulatory Network Compensation:

    • In vivo systems may activate alternative pathways to compensate for nuoA alterations

    • Analyze expression of functionally related genes (other dehydrogenases, alternative oxidases)

    • Investigate transcriptional regulators that respond to redox imbalances

  • Environmental Context Differences:

    • In vitro conditions may not replicate the complex in vivo environment

    • Test activity across a range of pH, ion concentrations, and redox states

    • Consider the impact of membrane composition on enzyme function

  • Protein-Protein Interactions:

    • nuoA may interact with unidentified partners in vivo

    • Perform interactome analyses to identify context-specific binding partners

    • Test activity in membrane extracts versus purified systems

  • Metabolic Integration Effects:

    • Changes in nuoA activity ripple through metabolism differently in whole cells

    • Conduct metabolic flux analysis to trace the consequences of altered activity

    • Examine NAD+/NADH ratios, which serve as key metabolic integrators

  • Temporal Considerations:

    • Short-term versus long-term adaptations to altered nuoA function

    • Implement time-course studies to capture adaptation dynamics

    • Consider how growth phase affects interpretation of results

This analytical framework parallels approaches used when reconciling enzymatic improvements in B. cereus glucose dehydrogenase with observed changes in antibacterial activity, where researchers found that changes in intracellular NADH/NAD+ ratios provided the mechanistic link between enzyme function and phenotypic outcomes .

What bioinformatic tools are most valuable for analyzing nuoA sequence-function relationships across Bacillus species?

For analyzing nuoA sequence-function relationships across Bacillus species, the following bioinformatic tools provide valuable insights:

  • Comparative Genomics Platforms:

    • PATRIC (Pathosystems Resource Integration Center) for analyzing nuoA in the context of complete Bacillus genomes

    • MicrobesOnline for gene neighborhood analysis and evolutionary relationships

    • IMG (Integrated Microbial Genomes) for functional annotation comparisons

  • Sequence Analysis Tools:

    • MEME Suite for motif discovery in nuoA sequences

    • ConSurf for identifying functionally important residues through evolutionary conservation

    • PROVEAN for predicting the functional impact of sequence variations

  • Structural Bioinformatics Resources:

    • AlphaFold2 for generating accurate structural models of nuoA variants

    • PyMOL or UCSF Chimera for structural visualization and analysis

    • COACH for predicting ligand-binding sites and protein-protein interfaces

  • Molecular Dynamics Platforms:

    • GROMACS for simulating nuoA behavior in membrane environments

    • NAMD with specialized force fields for membrane proteins

    • MDAnalysis for quantitative analysis of simulation trajectories

  • Phylogenetic Analysis Software:

    • IQ-TREE for maximum likelihood phylogenetic reconstruction

    • BEAST for Bayesian evolutionary analysis

    • PhyloBot for automated phylogenomic analysis workflows

  • Systems Biology Resources:

    • BioCyc for metabolic pathway comparisons across Bacillus species

    • STRING for protein association network analysis

    • CytoScape for visualizing and analyzing interaction networks

Similar bioinformatic approaches were successfully employed in the analysis of glucose dehydrogenase mutations in B. cereus, where conservation analysis and molecular docking identified critical residues for enzyme improvement, leading to significant increases in antibacterial activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.