Recombinant Bacillus cereus NADH-quinone oxidoreductase subunit K (nuoK)

What is Bacillus cereus NADH-quinone oxidoreductase subunit K (nuoK)?

NADH-quinone oxidoreductase subunit K (nuoK) is a membrane protein component of the respiratory chain complex I in Bacillus cereus. The full-length protein consists of 104 amino acids and functions as part of the NADH dehydrogenase I complex, which is critical for bacterial energy metabolism. The amino acid sequence (MSSVPASAYLTLAIILFCIGLFGALTKRNTVIVLVCIELMLNAANLNLVAFSKLGLFPNLTGQIFSLFTMAVAAAEAAVGLAILIALYRNRTTVHVDEMDTLKG) contains predominantly hydrophobic residues, consistent with its role as a membrane-spanning subunit .

What are the known functions of nuoK in Bacillus cereus?

NuoK functions as a subunit of NADH dehydrogenase I (NDH-1), which catalyzes the transfer of electrons from NADH to quinones in the respiratory chain. This process contributes to the establishment of a proton gradient across the membrane, which is subsequently used for ATP synthesis. In B. cereus, a pathogenic bacterium associated with foodborne illness, this energy metabolism is crucial for growth, survival, and potentially virulence factor production .

How does B. cereus differ from other Bacillus species in terms of NADH dehydrogenase activity?

While the search results don't provide specific comparative data on NADH dehydrogenase activity across Bacillus species, B. cereus is known for its distinct pathogenic properties. The function of respiratory chain complexes, including those containing nuoK, may be adapted to support the organism's lifestyle as both a soil saprophyte and an opportunistic pathogen. B. cereus produces various virulence factors, including enterotoxins (HBL, NHE, EntFM, and CytK) and emetic toxins, which require energy metabolism support through processes involving the respiratory chain .

What are the optimal conditions for expressing recombinant B. cereus nuoK protein?

Based on the commercial recombinant protein information, B. cereus nuoK can be successfully expressed in E. coli systems with an N-terminal His tag. The recombinant protein encompasses the full-length sequence (amino acids 1-104). For optimal expression, researchers should consider:

• Using E. coli strains optimized for membrane protein expression

• Induction conditions that prevent toxicity from membrane protein overexpression

• Lower induction temperatures (typically 18-25°C) to facilitate proper membrane protein folding

• Supplementation with appropriate cofactors if necessary for stability

What purification strategies are most effective for recombinant nuoK protein?

For His-tagged recombinant nuoK purification, a multi-step approach is recommended:

• Cell lysis using detergent-based buffers suitable for membrane proteins

• Initial purification via Ni-NTA affinity chromatography

• Size exclusion chromatography for further purification

• Storage in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability

• Lyophilization for long-term storage or storage at -20°C/-80°C with 5-50% glycerol to prevent freeze-thaw damage

How can researchers validate the structural integrity of purified nuoK protein?

To confirm structural integrity of the purified nuoK protein, researchers should employ multiple techniques:

• SDS-PAGE analysis to confirm >90% purity and expected molecular weight

• Western blotting using anti-His antibodies to verify tag presence

• Circular dichroism (CD) spectroscopy to assess secondary structure

• Limited proteolysis to evaluate protein folding

• Activity assays measuring electron transfer capability

• For advanced structural studies, consider native mass spectrometry or hydrogen-deuterium exchange mass spectrometry

What controls should be included when studying nuoK function in vitro?

When designing experiments to study nuoK function:

These controls help distinguish between specific nuoK-related effects and experimental artifacts .

How can researchers distinguish between nuoK-specific phenotypes and other respiratory chain effects?

To attribute phenotypes specifically to nuoK function rather than general respiratory chain disruption:

• Generate precise gene deletions or complementation constructs to create isogenic strains

• Use site-directed mutagenesis to modify specific residues rather than deleting the entire gene

• Compare phenotypes with mutants in other respiratory complex subunits

• Perform complementation studies using wild-type nuoK

• Measure multiple respiratory parameters (oxygen consumption, membrane potential, NADH/NAD+ ratios)

• Consider conditional expression systems for temporal control of nuoK expression

What methodologies are most reliable for studying membrane protein-protein interactions involving nuoK?

For studying nuoK interactions with other proteins:

• Bacterial two-hybrid assays modified for membrane proteins

• Co-immunoprecipitation using mild detergents to preserve interactions

• Cross-linking mass spectrometry (XL-MS) to capture transient interactions

• Förster resonance energy transfer (FRET) for live-cell interaction studies

• Surface plasmon resonance for quantitative binding kinetics

• Cryo-electron microscopy for structural characterization of the entire complex

How does nuoK contribute to B. cereus pathogenicity and virulence factor production?

While no direct evidence links nuoK to pathogenicity in the search results, respiratory chain function is fundamentally connected to bacterial metabolism and energy production needed for virulence factor synthesis. In B. cereus:

• Enterotoxin production (HBL, NHE, EntFM, CytK) requires significant energy resources

• Production of cereulide, the emetic toxin, is linked to metabolic state

• Growth rates in host environments depend on efficient energy metabolism

• Respiratory activity may influence adaptation to different oxygen tensions encountered during infection

• Energy metabolism impacts stress responses, potentially affecting survival during host-pathogen interactions

What structural features of nuoK are critical for its integration into the NADH dehydrogenase complex?

Analysis of the nuoK amino acid sequence reveals several structural features likely critical for function:

• Hydrophobic transmembrane regions essential for membrane anchoring

• Conserved charged residues potentially involved in proton translocation

• Loop regions that may interact with adjacent subunits

• Specific amino acid motifs likely involved in quinone binding and electron transfer

Researchers should focus on these regions when designing mutagenesis studies to understand structure-function relationships .

How do environmental conditions affect nuoK expression and activity in B. cereus?

Environmental factors likely influencing nuoK expression and activity include:

• Oxygen availability - affecting the need for aerobic respiration

• Growth phase - with potential differential expression during exponential vs. stationary phase

• Nutrient availability - altering energy metabolism requirements

• Temperature - B. cereus thrives at 30-37°C, potentially affecting protein folding and complex assembly

• pH - environmental acidity may alter proton motive force generation

• Presence of alternative electron acceptors - potentially leading to respiratory chain remodeling

What are common difficulties in working with recombinant nuoK and how can they be addressed?

Membrane proteins like nuoK present several research challenges:

These strategies can help overcome technical obstacles in nuoK research .

How can researchers accurately measure nuoK-specific activities within the larger NADH dehydrogenase complex?

To measure nuoK-specific activities:

• Generate point mutations that specifically affect nuoK function but allow complex assembly

• Develop assays that measure localized proton movement near the nuoK subunit

• Use site-specific labels or probes to monitor conformational changes during catalysis

• Reconstitute partial complexes with and without nuoK to assess its contribution

• Employ computational modeling to predict nuoK-specific functions that can be experimentally verified

• Use cross-linking approaches to determine dynamic interactions during the catalytic cycle

What approaches can resolve contradictory findings about nuoK function across different experimental systems?

When faced with contradictory results:

• Standardize protein preparation methods to ensure comparable starting materials

• Cross-validate findings using multiple experimental techniques

• Consider strain-specific differences - B. cereus is genetically diverse with potentially different nuoK variants

• Account for differences between recombinant systems and native expression

• Evaluate the influence of experimental conditions (pH, temperature, ionic strength)

• Perform collaborative cross-laboratory studies with standardized protocols

• Use systematic literature review and meta-analysis to identify experimental variables causing discrepancies

How does nuoK function relate to B. cereus survival in food matrices?

B. cereus is a significant food safety concern, with 35% of ready-to-eat (RTE) food samples testing positive in Chinese markets. The relationship between respiratory function and food matrix survival involves:

• Energy production for stress response in preserved foods

• Adaptation to varying oxygen levels within food packaging

• Metabolism during refrigeration (psychrotrophic strains)

• Energy requirements for toxin production in food environments

• Potential metabolic shifts between fermentation and respiration based on food composition

Understanding respiratory chain components like nuoK may inform strategies to control B. cereus in food systems .

What is the relationship between nuoK function and antibiotic resistance in B. cereus?

While not directly addressed in the search results, respiratory chain function can influence antibiotic susceptibility through:

• Energetic requirements for efflux pump activity

• Membrane potential effects on drug uptake

• Metabolic state influence on cell wall synthesis and repair

• Potential target for respiratory chain inhibitors as adjuvants

• Stress response coordination linked to both respiration and antimicrobial resistance

B. cereus isolates show resistance to β-lactam antibiotics and rifamycin, which may be partially influenced by metabolic adaptations involving respiratory complexes containing nuoK .

How can nuoK research contribute to understanding B. cereus evolution and ecological adaptation?

NADH dehydrogenase components like nuoK can provide insights into B. cereus evolution:

• Multilocus sequence typing (MLST) data from 368 B. cereus isolates revealed 192 different sequence types, suggesting high genetic diversity

• Comparing nuoK sequence conservation across these diverse strains could identify selective pressures

• Analyzing nuoK in different ecological niches (soil, food, clinical isolates) may reveal adaptive modifications

• Comparative genomics across the B. cereus group (including B. anthracis and B. thuringiensis) can highlight respiratory adaptations to different lifestyles

• Evolutionary rate analysis of respiratory genes versus virulence genes can reveal co-evolution patterns