Recombinant Bacillus cereus Probable disulfide formation protein C 2 (bdbC2)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics of bdbC2

bdbC2 (Gene ID: BCE_A0144) is encoded within the B. cereus genome and belongs to the DsbB family of disulfide bond-forming proteins. Key features include:

  • Structure: Membrane-bound oxidoreductase with a CXXC active-site motif for thiol-disulfide interchange .

  • Function: Facilitates disulfide bond formation in extracytoplasmic proteins, such as virulence factors or structural components (e.g., pseudopili) .

  • Homologs: Shares homology with Bacillus subtilis BdbC and E. coli DsbB, but exhibits species-specific functional adaptations .

Table 1: Key Genetic and Functional Attributes of bdbC2

AttributeDescriptionReference
Gene ClusterPart of conserved operons linked to competence or antibiotic production (e.g., sublancin 168)
Active SiteCXXC motif for redox activity
Subcellular LocalizationMembrane-associated
Host SystemsExpressed in E. coli, yeast, baculovirus, or mammalian cells for recombinant production

Recombinant Production and Purification

Recombinant bdbC2 is typically produced with affinity tags (e.g., 6x-His) for simplified purification. Key steps include:

  1. Cloning: Amplification of bdbC2 from B. cereus genomic DNA and insertion into expression vectors (e.g., pET49b) .

  2. Expression: Overexpression in E. coli hosts under optimized conditions .

  3. Purification: Nickel-affinity chromatography followed by thrombin cleavage to remove tags, yielding >85% purity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
bdbC2; BCE_A0144; Probable disulfide formation protein C 2; Disulfide oxidoreductase C 2; Thiol-disulfide oxidoreductase C 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Bacillus cereus (strain ATCC 10987 / NRS 248)
Target Names
bdbC2
Target Protein Sequence
MEWIRKYHIAIAWMIATSAMLISLFFSEWMKLPPCDLCWYQRMAMYPLVLILGIGMYRKD PRVSMYAFPFTCIGLILSVYQITIQAFPINEMKICSVGVSCTEDYLNLFGFISIPMLSFI GFLVIIILIYIESDRETKE
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain proteins.
Database Links
Protein Families
DsbB family, BdbC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is bdbC2 and what is its role in Bacillus cereus?

bdbC2 (Gene ID: BCE_A0144) is a membrane-bound oxidoreductase belonging to the DsbB family of disulfide bond-forming proteins in Bacillus cereus. It functions primarily to facilitate disulfide bond formation in extracytoplasmic proteins, including virulence factors and structural components such as pseudopili. The protein contains a characteristic CXXC active-site motif essential for thiol-disulfide interchange reactions. Unlike cytoplasmic disulfide formation proteins, bdbC2 operates in the extracytoplasmic space, contributing to protein stability and function in the bacterial envelope.

How does bdbC2 compare to similar proteins in other bacterial species?

bdbC2 shares homology with Bacillus subtilis BdbC and Escherichia coli DsbB, though it exhibits species-specific functional adaptations that reflect the unique physiological requirements of B. cereus. While the core catalytic mechanism involving the CXXC motif is conserved across these proteins, differences in substrate specificity and regulatory mechanisms exist. These variations likely evolved to accommodate differences in cell envelope architecture and secreted protein profiles between species. The membrane topology and oxidoreductase activity are functionally similar to other disulfide bond-forming proteins, though the protein interaction networks may differ substantially.

What genomic context surrounds the bdbC2 gene in B. cereus?

bdbC2 is part of conserved operons linked to competence development and/or antibiotic production (such as sublancin 168) in B. cereus. The genomic organization suggests functional coupling with other redox-active proteins and potentially with systems involved in protein export. This context provides important clues about the physiological role of bdbC2 beyond its biochemical function, suggesting involvement in complex cellular processes such as horizontal gene transfer, adaptation to environmental stresses, or competition with other microorganisms through antibiotic production.

What expression systems are most effective for recombinant bdbC2 production?

Recombinant bdbC2 can be successfully expressed in several heterologous systems including E. coli, yeast, baculovirus, and mammalian cells. For research purposes, E. coli remains the most common host due to its rapid growth, high protein yields, and established genetic manipulation techniques. When expressing membrane proteins like bdbC2, E. coli strains with enhanced membrane protein expression capabilities (such as C41(DE3) or C43(DE3)) often provide better results. The choice of expression system should consider the research goals—whether native-like activity, high yield, or specific post-translational modifications are prioritized.

What is the recommended protocol for cloning and expressing bdbC2?

A robust protocol for bdbC2 expression involves:

  • Amplification of the bdbC2 gene from B. cereus genomic DNA using high-fidelity DNA polymerase

  • Cloning into an appropriate expression vector (e.g., pET49b) incorporating an affinity tag (typically 6x-His)

  • Transformation into a suitable E. coli expression strain

  • Induction of protein expression under optimized conditions (temperature, inducer concentration, duration)

The addition of the affinity tag should be designed to minimize interference with protein folding and function. C-terminal tagging is often preferred for membrane proteins to avoid disrupting signal sequences or membrane insertion, though this should be empirically determined for bdbC2.

What purification strategy yields the highest purity bdbC2 preparations?

A multi-step purification approach typically yields the highest purity (>85%) bdbC2 preparations:

  • Cell lysis under conditions that preserve membrane protein structure

  • Membrane fraction isolation via differential centrifugation

  • Solubilization using appropriate detergents (e.g., n-dodecyl-β-D-maltoside)

  • Nickel-affinity chromatography for His-tagged protein capture

  • Thrombin cleavage to remove the affinity tag (if desired)

  • Size-exclusion chromatography for final polishing

Maintaining reducing conditions throughout purification may be necessary to prevent non-native disulfide formation between bdbC2 molecules. Inclusion of protease inhibitors and performing all steps at 4°C helps minimize degradation.

How can the redox activity of bdbC2 be accurately measured?

The redox activity of bdbC2 can be assessed through several complementary approaches:

  • Thiol-disulfide exchange kinetics: Using fluorescent or chromogenic thiol reagents to monitor real-time disulfide formation

  • Non-reducing SDS-PAGE: Monitoring mobility shifts between oxidized and reduced forms of substrate proteins, as reduced and oxidized proteins migrate differently

  • Enzyme-coupled assays: Linking bdbC2 activity to a secondary reaction with measurable output

  • Direct electrochemical methods: Using electrodes to measure electron transfer associated with redox reactions

When designing these assays, it's critical to control the ambient redox environment and consider the influence of detergents on protein activity, as bdbC2 is naturally membrane-associated.

What is the significance of the CXXC motif in bdbC2 function?

The CXXC motif forms the active site of bdbC2 and is essential for its thiol-disulfide oxidoreductase activity. The two cysteine residues undergo reversible oxidation and reduction during catalysis, facilitating electron transfer between substrate proteins. Site-directed mutagenesis studies of these cysteines typically result in complete loss of enzymatic activity. The amino acids between the cysteines (XX) influence the redox potential of the active site, thereby affecting substrate specificity and reaction rates. This motif is highly conserved among disulfide bond-forming proteins across bacterial species, highlighting its fundamental importance in protein folding and stability.

How does the oligomeric state of bdbC2 affect its function?

Like other disulfide formation proteins such as Fnr in B. cereus, the oligomeric state of bdbC2 may significantly influence its activity. Disulfide bridges can play a crucial role in oligomerization, as demonstrated by the dithiothreitol sensitivity of oligomeric states in related proteins . For membrane proteins like bdbC2, the oligomeric state may be particularly important for creating a functional environment for substrate interaction. Analytical techniques such as size exclusion chromatography, analytical ultracentrifugation, and native PAGE can be employed to characterize the relationship between oligomeric state and activity.

How does bdbC2 contribute to B. cereus virulence and adaptation to host environments?

bdbC2 likely contributes to B. cereus virulence through proper folding of secreted toxins and virulence factors that require disulfide bonds for stability and function. In the context of host adaptation, bdbC2 may be particularly important in the intestinal environment where redox conditions fluctuate. Studies of B. cereus adaptation to the gastrointestinal tract environment indicate that redox-active proteins play crucial roles in surviving intestinal conditions characterized by low oxidation-reduction potential (ORP) .

Proteome analysis using nanoLC-MS/MS techniques has revealed that redox systems are integral to B. cereus adaptation to varying environmental conditions. The proper folding of extracellular proteins through disulfide bond formation may be essential for bacterial persistence and pathogenicity in the host.

What techniques can reveal bdbC2's substrate specificity and interaction network?

Several approaches can elucidate bdbC2's substrate specificity and protein interaction network:

  • Proteomic identification of substrates: Using comparative proteomics to identify proteins with altered disulfide patterns in bdbC2 mutants

  • Trapping mutants: Creating bdbC2 variants that form stable mixed disulfides with substrates

  • Pull-down assays: Using tagged bdbC2 to co-purify interacting proteins

  • Bacterial two-hybrid assays: Screening for protein-protein interactions

  • Cross-linking coupled with mass spectrometry: Identifying proximal proteins in vivo

These methods may reveal connections between bdbC2 and virulence factors, particularly enterotoxins like Hbl and Nhe, which are regulated by redox-sensitive transcription factors in B. cereus .

How do redox conditions influence bdbC2 activity in different cellular compartments?

The activity of bdbC2 is likely influenced by the distinct redox environments of different cellular compartments. Like other disulfide-forming proteins, bdbC2 function depends on the ambient redox potential, which varies considerably between cytoplasm, membrane, and extracellular space. Experimental approaches to investigate this include:

  • Creating redox-buffered in vitro systems that mimic different cellular compartments

  • Using redox-sensitive fluorescent probes to monitor compartment-specific redox potentials

  • Employing redox proteomics to measure the oxidation state of bdbC2 in different cellular fractions

These investigations are particularly relevant because B. cereus adapts to varying redox conditions, including the low ORP anoxic environment of the intestinal lumen .

What strategies can overcome poor expression or inclusion body formation of recombinant bdbC2?

When encountering poor expression or inclusion body formation with recombinant bdbC2, consider implementing these strategies:

  • Optimize induction conditions: Lower temperatures (16-25°C), reduced inducer concentrations, and extended expression times often improve membrane protein folding

  • Use specialized E. coli strains: C41(DE3), C43(DE3), or Lemo21(DE3) strains are engineered for improved membrane protein expression

  • Adjust fusion tags: N-terminal tags like MBP or SUMO can enhance solubility

  • Co-express chaperones: GroEL/GroES, DnaK/DnaJ, or specific membrane protein assembly factors

  • Optimize lysis and extraction: Screen multiple detergents for efficient extraction from membranes

If inclusion bodies persist, protocols for refolding can be developed, though these are generally more challenging for membrane proteins like bdbC2.

How can researchers distinguish between native and non-native disulfide bonds in bdbC2 preparations?

Distinguishing between native and non-native disulfide bonds is crucial for functional studies of bdbC2. Implement these analytical approaches:

  • Mass spectrometry: Peptide mapping with MS can identify specific disulfide linkages

  • Differential alkylation: Sequential labeling of free thiols before and after reduction

  • Functional assays: Compare activity of preparations with different disulfide patterns

  • Circular dichroism: Monitor secondary structure changes associated with different disulfide configurations

Native disulfide formation typically results in more compact, stable protein conformations with preserved enzymatic activity, while non-native disulfides often lead to misfolding and aggregation.

What controls should be included when studying bdbC2-mediated disulfide formation?

Robust experimental design for studying bdbC2-mediated disulfide formation should include these controls:

  • Redox buffer controls: Compare activity in reducing, redox-balanced, and oxidizing environments

  • Catalytically inactive mutant: A C→A substitution in the CXXC motif provides a negative control

  • Alternative oxidoreductases: Compare with homologous proteins (DsbB, BdbC) to assess specificity

  • Non-substrate proteins: Include proteins without cysteines to confirm specificity

  • Time course analysis: Monitor reaction progress to distinguish enzymatic from spontaneous reactions

These controls help distinguish bdbC2-specific effects from background oxidation/reduction and non-enzymatic disulfide exchange.

How might bdbC2 function be exploited for biotechnological applications?

bdbC2's disulfide bond-forming capability offers several potential biotechnological applications:

  • Enhanced recombinant protein production: Co-expression of bdbC2, particularly for disulfide-rich proteins like antibody fragments

  • Biosensor development: Creating bdbC2-based redox sensors for environmental monitoring

  • Antimicrobial development: Targeting bdbC2 to disrupt pathogen virulence

  • Protein engineering platforms: Using bdbC2 to create novel disulfide patterns in custom proteins

The membrane-associated nature of bdbC2 might also be exploited in immobilized enzyme systems for continuous biocatalysis applications.

What is the relationship between bdbC2 and other redox systems in B. cereus stress response?

The interplay between bdbC2 and other redox systems in B. cereus remains an important area for investigation. B. cereus employs multiple redox-responsive systems to adapt to environmental changes, including the ResDE two-component system and the Fnr one-component system .

Future research should explore how bdbC2 functions within this broader redox network, particularly:

  • How bdbC2 activity is regulated under different stress conditions

  • Whether bdbC2 functions cooperatively with cytoplasmic thiol-disulfide oxidoreductases

  • The potential role of bdbC2 in response to oxidative stress, particularly in relation to OhrA and OhrR, which regulate proteome composition under varying ORP conditions

What genomic and proteomic approaches can further elucidate bdbC2 function in diverse B. cereus strains?

Advanced genomic and proteomic approaches to investigate bdbC2 function across diverse B. cereus strains include:

  • Comparative genomics: Analyzing bdbC2 sequence conservation and operon structure across strains

  • Transcriptomics: RNA-seq analysis of bdbC2 expression under various conditions

  • Proteome-wide interaction mapping: Using proximity labeling techniques to identify bdbC2 interaction partners

  • High-throughput phenotyping: Screening bdbC2 mutants across diverse growth conditions

  • NanoLC-MS/MS proteomics: Quantifying proteome changes in response to bdbC2 perturbation

These approaches would help establish whether bdbC2 function is conserved across the B. cereus group or shows strain-specific adaptations related to unique ecological niches or pathogenic potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.