Recombinant Bacillus cereus Probable disulfide formation protein C (bdbC)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Probable Disulfide Formation Protein C (BdbC) belongs to the thiol-disulfide oxidoreductase (TDOR) family, homologous to Escherichia coli DsbB. It functions in Gram-positive bacteria to introduce disulfide bonds into substrate proteins, stabilizing their tertiary structures . In B. cereus, BdbC is implicated in redox homeostasis and extracellular protein folding, particularly during natural competence—a state enabling DNA uptake .

Gene Information

  • Gene Name: BCE_A0144 (primary locus) .

  • Orthologs: bdbC in Bacillus subtilis and Coxiella burnetii .

  • Operon Context: Often co-located with competence-related genes (e.g., comGA) .

Protein Properties

PropertyDetails
Molecular FunctionThiol-disulfide oxidoreductase; introduces disulfide bonds via CXXC active site motifs .
StructureThioredoxin-like domain with an inserted helical domain; Ca²⁺-binding site enhances stability .
Redox PotentialMidpoint reduction potential: −75 mV (vs. NHE), modulated by Ca²⁺ occupancy .
Host SystemsExpressed in E. coli, yeast, baculovirus, or mammalian cells .
Purity≥85% (SDS-PAGE) .

Oxidative Folding Pathway

BdbC partners with BdbD (a DsbA homolog) to form a redox relay system:

  1. BdbD oxidizes substrate proteins, transferring electrons to BdbC .

  2. BdbC re-oxidizes BdbD via quinone intermediates in the membrane .

  3. Ca²⁺ binding stabilizes BdbD’s structure, boosting its oxidizing power .

Role in Natural Competence

  • BdbC/BdbD facilitates disulfide bond formation in the ComCG pseudopilus, a structure critical for DNA uptake .

  • Competence in B. cereus is induced by heterologous expression of B. subtilis ComK, which activates bdbC transcription .

Expression Systems

  • Hosts: E. coli (most common), yeast, baculovirus .

  • Purification: Affinity chromatography followed by SDS-PAGE validation .

Key Applications

  1. Biotechnological Protein Production:

    • Enables secretion of disulfide-bonded proteins (e.g., E. coli alkaline phosphatase) in Bacillus expression platforms .

  2. Antibiotic Synthesis:

    • Required for sublancin 168 production in B. subtilis .

  3. Structural Studies:

    • Crystal structures of BdbD (homolog) reveal Ca²⁺-dependent redox modulation .

Research Challenges and Innovations

  • Redox Compatibility: BdbC/BdbD systems are less efficient than E. coli DsbA/DsbB but are adaptable via Ca²⁺-mediated stabilization .

  • Genome Engineering: Deletion of competing reductases in B. subtilis improves yields of disulfide-bonded proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly sent with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
bdbC; BC_0779; Probable disulfide formation protein C; Disulfide oxidoreductase C; Thiol-disulfide oxidoreductase C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)
Target Names
bdbC
Target Protein Sequence
MGREKKQEYALLTAWGASFIATLGSLYFSEIMKFEPCVLCWYQRIFMYPFVLWLGIAVAK KDYRIASYSLPIASIGACISLYHYAIQKVAAFSAAGAACGRVPCTGEYINWFGFVTIPFL ALIGFITIAVCSFIVIKNK
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in some proteins.
Database Links

KEGG: bce:BC0779

STRING: 226900.BC0779

Protein Families
DsbB family, BdbC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and localization of bdbC2 in Bacillus cereus?

Recombinant Bacillus cereus Probable disulfide formation protein C 2 (bdbC2) is a membrane-bound oxidoreductase encoded by the BCE_A0144 gene in the B. cereus genome. The protein contains a characteristic CXXC active-site motif critical for thiol-disulfide interchange reactions. This structural arrangement is consistent with its function as a membrane-associated protein involved in electron transfer processes.

For structural analysis of bdbC2, researchers should employ:

  • X-ray crystallography with appropriate membrane protein crystallization techniques

  • NMR spectroscopy for dynamic regions

  • Cryo-electron microscopy for in situ structural determination

When examining subcellular localization, fluorescence microscopy with GFP-tagged bdbC2 constructs can confirm membrane association, while subcellular fractionation followed by Western blotting provides biochemical verification of localization patterns.

How does bdbC2 compare functionally to homologous proteins in other bacterial species?

bdbC2 shares significant homology with Bacillus subtilis BdbC and Escherichia coli DsbB, though with notable species-specific adaptations. Key functional comparisons include:

ProteinOrganismKey FeaturesFunctional Distinctions
bdbC2B. cereusCXXC motif; membrane-associatedPotentially linked to virulence factor folding
BdbCB. subtilisCXXC motif; part of competence operonInvolved in natural competence and sublancin production
DsbBE. coliCXXC motif; works with DsbAMore extensively characterized; broader substrate range

Methodologically, comparative functional analysis should employ:

  • Heterologous complementation assays where bdbC2 is expressed in ΔdsbB E. coli or ΔbdbC B. subtilis strains

  • In vitro reconstitution of electron transfer using purified components

  • Substrate profiling using proteomics to identify species-specific targets

Such comparative approaches reveal how similar structural frameworks have evolved distinct functional specializations across bacterial species.

What expression systems are most effective for producing recombinant bdbC2?

The optimal expression system depends on research objectives and downstream applications. For membrane proteins like bdbC2, several approaches have proven effective:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield; cost-effective; rapid; compatible with membrane protein tagsPotential improper folding; inclusion body formationInitial structural studies; antibody production
Yeast (P. pastoris)Eukaryotic folding machinery; post-translational modifications; high density cultureLonger production time; glycosylation patterns differ from nativeFunctional studies requiring proper folding
BaculovirusHigh expression; proper folding of complex proteinsTechnical complexity; higher costStructural biology; activity assays
Mammalian cellsNative-like folding; suitable for interaction studiesLowest yield; highest costInteraction studies with host factors

Methodological considerations include:

  • For E. coli expression, use specialized strains (C41, C43) designed for membrane proteins

  • Include fusion tags (His, MBP, GST) positioned to avoid interference with CXXC active site

  • Optimize induction conditions (temperature, IPTG concentration, induction timing)

  • For membrane proteins, mild detergents (DDM, LDAO) during purification preserve native structure

When designing experiments, researchers should consider the established principles of experimental design, including the need for controls, hypothesis testing, limiting biological variation, and independent replication .

How can CRISPR/Cas9 be used to engineer bdbC2 modifications in B. cereus?

CRISPR/Cas9 technology has recently been adapted for highly efficient genome engineering in the Bacillus cereus group. For bdbC2 modifications, the following methodology is recommended:

  • Design stage:

    • Select target sequence near bdbC2 gene with PAM site (NGG)

    • Design sgRNA with minimal off-target effects

    • Create homology-directed repair (HDR) template containing desired modifications flanked by homology arms (500-1000bp each)

  • Implementation protocol:

    • Clone sgRNA into a Cas9-expressing vector compatible with B. cereus

    • Transform cells with both the CRISPR vector and HDR template

    • Screen transformants using PCR and sequence verification

Recent advances in B. cereus CRISPR/Cas9 systems have demonstrated success rates of 20-100% for large fragment deletions . This approach allows marker-free modification of bdbC2, enabling precise point mutations in the CXXC motif or complete gene deletion without antibiotic selection markers .

When using this technology, researchers should implement proper controls including:

  • Non-targeting sgRNA control

  • Wild-type sequence verification

  • Phenotypic characterization to confirm functional consequences

What role does bdbC2 play in B. cereus virulence and how can this be experimentally determined?

bdbC2 likely contributes to B. cereus virulence through its role in disulfide bond formation in secreted virulence factors. To experimentally investigate this relationship:

  • Generate precise bdbC2 mutants using CRISPR/Cas9:

    • Complete deletion mutants

    • Active site (CXXC) point mutations

    • Conditional expression constructs

  • Perform comparative virulence assays:

    • In vitro: Measure hemolytic activity, phospholipase production, and biofilm formation

    • Ex vivo: Assess survival in macrophage infection models

    • In vivo: Determine LD50 in appropriate animal models

  • Conduct proteomic analysis to identify affected virulence factors:

    • Compare wild-type and mutant secretomes using LC-MS/MS

    • Analyze disulfide bond status using non-reducing SDS-PAGE

    • Apply redox proteomics to identify specific substrates

This approach parallels research on PlcR in B. cereus, where precise point mutations have been used to investigate virulence regulation . The PlcR regulatory system provides an instructive model, as B. anthracis contains a natural nonsense mutation at position 640 that renders PlcR non-functional, significantly impacting its virulence profile compared to B. cereus .

How might structural information about bdbC2 inform antimicrobial development?

Targeting disulfide bond formation represents a promising antimicrobial strategy, as this pathway is critical for proper folding of many virulence factors. A structure-guided approach includes:

  • Obtain high-resolution structural data:

    • Submit purified bdbC2 protein to structure determination repositories like the Protein Data Bank (PDB)

    • Use X-ray crystallography, NMR, or cryo-EM depending on protein characteristics

    • Model active site interactions using molecular dynamics simulations

  • Structure-based inhibitor design:

    • Identify unique features of the CXXC active site

    • Perform virtual screening against the active site pocket

    • Design peptidomimetics that compete with natural substrates

  • Validation methodology:

    • In vitro enzyme inhibition assays measuring redox activity

    • Bacterial growth inhibition studies

    • Assessment of synergy with existing antibiotics

The PDB currently houses numerous protein structures that can serve as templates and comparative models . Researchers should utilize these resources for structure-based approaches while ensuring proper deposition of new structural data to benefit the scientific community.

What bioinformatic approaches are most valuable for analyzing bdbC2 sequence-structure-function relationships?

Comprehensive bioinformatic analysis of bdbC2 should incorporate:

  • Sequence analysis pipeline:

    • Multiple sequence alignment of bdbC homologs across species

    • Identification of conserved motifs beyond the CXXC active site

    • Phylogenetic reconstruction to trace evolutionary relationships

  • Structure prediction methodology:

    • Homology modeling based on related proteins with known structures

    • Ab initio modeling for unique regions

    • Molecular dynamics simulations to assess flexibility and conformational states

  • Integrated structure-function analysis:

    • Mapping conservation scores to structural models

    • Prediction of protein-protein interaction interfaces

    • Correlating sequence variation with functional diversification

When analyzing membrane proteins like bdbC2, specialized tools for transmembrane topology prediction should be employed alongside general protein structure prediction algorithms. Results should be validated against experimental data whenever possible to ensure biological relevance.

How can researchers optimize experimental design when investigating bdbC2 interactions with substrate proteins?

Investigating protein-protein interactions involving membrane proteins presents unique challenges. Researchers should:

  • Employ complementary interaction detection methods:

    • Pull-down assays using tagged bdbC2 followed by mass spectrometry

    • Bacterial two-hybrid systems adapted for membrane proteins

    • In vivo crosslinking to capture transient interactions

  • Design proper controls and replicates:

    • Include inactive bdbC2 mutants (CXXC → AXXA) as negative controls

    • Perform reverse pull-downs with identified substrate proteins

    • Include biological replicates (minimum n=3) for statistical validity

  • Quantitatively assess interaction specificity:

    • Calculate enrichment ratios compared to non-specific controls

    • Apply appropriate statistical tests to distinguish genuine interactions

    • Validate key interactions using orthogonal methods

What emerging technologies could advance our understanding of bdbC2 function in B. cereus?

Several cutting-edge technologies show promise for deeper investigation of bdbC2:

  • Time-resolved structural methods:

    • Serial femtosecond crystallography to capture reaction intermediates

    • Single-molecule FRET to observe conformational dynamics

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • In situ characterization approaches:

    • Cryo-electron tomography to visualize bdbC2 in native membrane context

    • Super-resolution microscopy to track spatial organization

    • Proximity labeling (BioID, APEX) to map local protein environment

  • Systems-level functional assessment:

    • CRISPRi for tunable repression of bdbC2 expression

    • RNAseq to analyze transcriptional responses to bdbC2 perturbation

    • Metabolomics to identify downstream effects on cellular physiology

These approaches move beyond traditional structural and biochemical analyses to provide dynamic, contextual, and systems-level insights into bdbC2 function, potentially revealing novel roles beyond the currently established disulfide bond-forming activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.