Recombinant Bacillus cereus Prolipoprotein diacylglyceryl transferase 1 (lgt1)

Shipped with Ice Packs
In Stock

Description

Table 1: Recombinant Lgt1 Variants

Strain SourceUniprot IDLength (AA)Expression SystemTag Type
ATCC 10987 Q72XV7270E. coliUndisclosed
G9842 B7IPS6PartialBaculovirusDetermined during production

Functional Role in B. cereus Pathogenicity

Lgt1 modifies prolipoproteins by attaching a diacylglyceryl moiety to a conserved cysteine residue within the lipobox motif ([LVI][ASTVI][GAS]C) . This step is indispensable for:

  • Membrane Localization: Lipoproteins are routed to the outer membrane via the Lol transport system .

  • Toxin Secretion: Lgt1 activity indirectly regulates virulence factors like hemolysin BL (HBL) and non-hemolytic enterotoxin (Nhe) . Strains lacking functional Lgt1 show reduced cytotoxicity due to impaired toxin secretion .

  • Antibiotic Resistance: Lipoproteins stabilize the outer membrane; Lgt1 inhibition disrupts membrane integrity, enhancing susceptibility to antibiotics and host immune defenses .

Biochemical Assays

Recombinant Lgt1 enables in vitro studies of its enzymatic mechanism. For example:

  • Activity Measurement: A coupled luciferase assay detects glycerol phosphate release during diacylglyceryl transfer . Inhibitors like G9066 and G2823 show IC₅₀ values of 0.24 μM and 0.93 μM, respectively .

  • Inhibitor Screening: Identified Lgt inhibitors (Lgti) are bactericidal against E. coli and A. baumannii, validating Lgt1 as a drug target .

Pathogenicity Studies

  • Gene Knockout Effects: Depleting lgt1 in B. cereus reduces HBL-mediated NLRP3 inflammasome activation and host cell pyroptosis .

  • Regulatory Networks: Lgt1 activity intersects with transcriptional regulators like PlcR and ResD, which control toxin gene expression .

Table 2: Key Research Insights

Study FocusMethodologyKey OutcomeSource
Inhibitor EfficacyIn vitro assaysLgti compounds show nanomolar IC₅₀ values
Toxin SecretionΔlgt1 mutants50% reduction in Caco-2 cell cytotoxicity
Structural AnalysisHomology modelingIdentified phosphatidylglycerol-binding site

Future Directions

While recombinant Lgt1 has advanced antibacterial drug development, unresolved questions remain:

  • Resistance Mechanisms: No on-target resistance mutations have been observed, suggesting Lgt1 inhibitors may evade common resistance pathways .

  • Structural Studies: High-resolution crystallography could refine inhibitor design by elucidating substrate-binding dynamics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference for your application.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its implementation.
Synonyms
lgt1; BCE_5266; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bacillus cereus (strain ATCC 10987 / NRS 248)
Target Names
lgt1
Target Protein Sequence
MLLGSVPQLDRVAIQLGPFPVYWYGIIIGTGVLLGLWLATREGERLGIPKDTFVDLVLIA VPIAILFARMYYVIFEWEYYAQNPSQIINIRQGGLAIHGGLIGAVITGILFAKRRGVSFW KLADIAAPSILLGQAIGRWGNFMNQEAHGDEVTRQFLEGLHLPDFIINQMYIDGVYYHPT FLYESLWNFAGVILLLALRKVNLRRGELFFTYLIWYSIGRFFVEGLRTDSLMLGPLRIAQ VMSIGLVVISVIFIIVRRKMGQADKRYLEN
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase 1 (Lgt1) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: bca:BCE_5266

Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase 1 (lgt1) in Bacillus cereus?

Prolipoprotein diacylglyceryl transferase 1 (lgt1) is a critical enzyme in Bacillus cereus that catalyzes the first step in bacterial lipoprotein biosynthesis. This enzyme attaches lipid anchors (diacylglyceryl groups) to prolipoproteins, creating lipoproteins that play crucial roles in bacterial physiology and virulence. The function of lgt1 in B. cereus is similar to that observed in related Bacillus species, such as B. anthracis, where the enzyme facilitates the attachment of lipid anchors to prolipoproteins, enabling proper cellular localization and function .

How does the lipoprotein biosynthesis pathway function in Bacillus species?

In Bacillus species, lipoprotein biosynthesis follows a conserved pathway:

  • Prolipoprotein synthesis occurs with an N-terminal signal peptide containing a lipobox motif

  • The prolipoprotein diacylglyceryl transferase (lgt) attaches a diacylglyceryl group to the conserved cysteine residue in the lipobox

  • Signal peptidase II cleaves the signal peptide, leaving the modified cysteine at the N-terminus

  • For some lipoproteins in certain bacteria, additional modifications may occur

Research with B. anthracis has demonstrated that disruption of this pathway through lgt deletion results in bacteria lacking lipoproteins, as confirmed by 14C-palmitate labeling, and exhibiting decreased surface hydrophobicity . This pattern is expected to be similar in B. cereus given the genetic relatedness between these species.

What role do bacterial lipoproteins play in virulence?

Bacterial lipoproteins serve as crucial mediators of virulence in many Gram-positive bacteria, including Bacillus species. These functions include:

FunctionVirulence Contribution
ImmunomodulationTrigger TLR2-dependent inflammatory responses
Nutrient acquisitionFacilitate uptake of essential nutrients during infection
AdhesionMediate attachment to host tissues
Spore germinationSupport efficient spore germination in host environments

Studies in B. anthracis show that deletion of the lgt gene significantly reduces TLR2-dependent TNF-α responses from macrophages exposed to the bacteria. Additionally, spores of lgt mutants exhibit inefficient germination both in vitro and in mouse models, leading to attenuated virulence in subcutaneous infection models . Similar mechanisms likely operate in B. cereus, particularly considering its presence in ready-to-eat foods where it can cause food poisoning .

How is lgt conserved across Bacillus cereus group members?

The lgt gene shows high conservation across the Bacillus cereus group, which includes B. cereus, B. anthracis, and B. thuringiensis. This conservation reflects the essential nature of lipoprotein biosynthesis in bacterial physiology. While specific sequence comparisons aren't provided in the search results, research on B. anthracis indicates that disruption of the lgt gene affects bacterial properties similarly to what would be expected in related species, suggesting functional conservation . The B. cereus group is known to share many virulence factors and physiological systems, with MLST analysis showing genetic relationships among strains .

How should I design experiments to study lgt1 function in B. cereus?

When designing experiments to study lgt1 function in B. cereus, follow these structured approaches:

  • Define variables clearly:

    • Independent variable: Presence/absence of functional lgt1 (wild-type vs. mutant)

    • Dependent variables: Lipoprotein production, surface hydrophobicity, virulence factors

    • Extraneous variables: Growth conditions, genetic background of strains

  • Formulate specific, testable hypotheses:

    • Example: "Deletion of lgt1 in B. cereus will reduce lipoprotein anchoring as measured by 14C-palmitate labeling"

  • Design experimental treatments:

    • Generate lgt1 deletion mutants using gene replacement techniques

    • Complement mutants with functional lgt1 to verify phenotype restoration

    • Include wild-type controls under identical conditions

  • Assign subjects to experimental groups:

    • Between-subjects design: Compare wild-type, mutant, and complemented strains

    • Within-subjects design: Test same strains under different conditions

  • Plan measurements:

    • Quantitative assays: 14C-palmitate labeling, hydrocarbon partitioning

    • Functional assays: Virulence factor secretion, germination efficiency

What methods can be used to create and validate an lgt1 deletion mutant in B. cereus?

Creating and validating an lgt1 deletion mutant in B. cereus involves several critical steps:

Generation of the mutant:

  • Design primers targeting regions flanking the lgt1 gene

  • Amplify these regions and join them in a deletion construct

  • Clone the construct into a suicide vector containing a selectable marker

  • Introduce the vector into B. cereus through electroporation

  • Select for single crossover integrants using appropriate antibiotics

  • Counter-select for double crossover events to obtain clean deletion mutants

Validation protocols:

  • PCR verification using primers flanking the deleted region

  • Whole-genome sequencing to confirm clean deletion without additional mutations

  • Complementation with functional lgt1 to verify phenotype restoration

  • 14C-palmitate labeling to confirm absence of lipoproteins (as demonstrated in B. anthracis)

  • Hydrocarbon partitioning to measure changes in surface hydrophobicity

This comprehensive validation ensures the observed phenotypes are specifically due to lgt1 deletion rather than polar effects or secondary mutations.

What techniques are available for studying the role of lgt1 in B. cereus virulence?

Several experimental approaches can effectively assess the role of lgt1 in B. cereus virulence:

In vitro techniques:

  • Lipoprotein quantification: Use 14C-palmitate labeling to confirm lipoprotein anchoring

  • Toxin production analysis: Measure levels of enterotoxins (NHE, HBL, CytK, EntFM) and emetic toxin (cereulide) using ELISA or gene expression assays

  • Macrophage response assays: Assess TLR2-dependent TNF-α production by macrophages exposed to wild-type versus lgt1 mutant bacteria

  • Germination efficiency tests: Compare spore germination rates in vitro under various conditions

In vivo techniques:

  • Murine infection models: Assess virulence using established models such as:

    • Subcutaneous infection model to compare lesion formation and dissemination

    • Gastrointestinal infection model to evaluate food poisoning capacity

  • Germination assessment in vivo: Analyze spore germination efficiency in mouse skin or other tissues

Comprehensive phenotypic analysis should include comparing vegetative cells versus spores, as research in B. anthracis indicates different virulence impacts depending on the bacterial form .

What controls should be included when studying recombinant lgt1 activity?

When studying recombinant lgt1 activity, the following controls are essential:

Negative controls:

  • Reaction mixture without the recombinant lgt1 enzyme

  • Heat-inactivated recombinant lgt1 to confirm enzyme specificity

  • Recombinant lgt1 with site-directed mutations in catalytic residues

  • Substrate analogs lacking the lipobox motif required for modification

Positive controls:

  • Known functional lgt from related species (e.g., B. anthracis lgt)

  • Well-characterized synthetic substrates with confirmed lipobox motifs

  • Naturative native B. cereus lipoproteins for in vitro assay calibration

Experimental validation controls:

  • Mass spectrometry to confirm diacylglyceryl transfer to target proteins

  • Size-exclusion chromatography to verify protein folding and oligomeric state

  • Circular dichroism to assess secondary structure integrity

  • Calibration curves for quantitative enzymatic activity measurements

These controls help validate assay specificity, ensure enzyme functionality, and provide benchmarks for comparing experimental results across different conditions or enzyme variants.

How does lgt1 activity contribute to B. cereus virulence in food poisoning scenarios?

The role of lgt1 in B. cereus food poisoning virulence involves multiple mechanisms:

B. cereus causes food poisoning through two primary mechanisms: the diarrheal syndrome (mediated by enterotoxins) and the emetic syndrome (caused by cereulide). Lipoproteins processed by lgt1 likely contribute to both pathways:

  • Enterotoxin production regulation: While the enterotoxins themselves (NHE, HBL, CytK, EntFM) are not typically lipoproteins, their production and secretion may be influenced by lipoprotein-dependent signaling systems. Studies show that 83% of B. cereus isolates harbor the nheABC gene cluster, and all possess the entFM gene, indicating widespread enterotoxin potential .

  • Spore germination efficiency: Research in B. anthracis demonstrates that lgt deletion impairs spore germination both in vitro and in vivo . Similarly, B. cereus spores in food likely require efficient lipoprotein processing for optimal germination in the gastrointestinal tract. Inefficient germination would reduce vegetative cell numbers and subsequent toxin production.

  • Adaptation to food environments: B. cereus has been detected in 35% of ready-to-eat food samples across China, with contamination levels between 3-1100 MPN/g in 68% of positive samples and exceeding 1100 MPN/g in 10% of samples . Lipoproteins likely contribute to adaptation to these food matrices, influencing survival and subsequent virulence.

Understanding these mechanisms can inform food safety measures and therapeutic strategies for B. cereus food poisoning.

What is the relationship between lgt1 function and antibiotic resistance in B. cereus?

The relationship between lgt1 function and antibiotic resistance in B. cereus involves several interconnected mechanisms:

  • Cell envelope integrity: Lipoproteins contribute to cell envelope structure, potentially affecting antibiotic permeability

  • Efflux pump regulation: Some lipoproteins may participate in regulatory networks controlling expression of efflux systems

  • Stress response coordination: Lipoproteins often function in stress response pathways that can confer transient antibiotic tolerance

Experimental considerations for studying this relationship:

  • Compare minimum inhibitory concentrations (MICs) between wild-type and lgt1 mutant strains across multiple antibiotic classes

  • Analyze expression of resistance genes in the presence and absence of functional lgt1

  • Assess membrane permeability changes in lgt1 mutants that might affect antibiotic penetration

  • Investigate whether antibiotic exposure alters lgt1 expression or activity

This research direction could reveal novel approaches to combat B. cereus antibiotic resistance, which is particularly concerning given its presence in ready-to-eat foods .

How might genetic polymorphisms in lgt1 affect B. cereus virulence potential?

Genetic polymorphisms in lgt1 could significantly impact B. cereus virulence through several mechanisms:

Potential impacts of lgt1 polymorphisms:

  • Altered substrate specificity: Mutations in the substrate-binding pocket could change the range of prolipoproteins modified by lgt1

  • Enzyme efficiency variation: Polymorphisms affecting catalytic residues or protein stability might alter the rate of lipoprotein processing

  • Strain-specific virulence patterns: Different lgt1 variants might contribute to the diverse virulence profiles observed across B. cereus strains

Analysis approaches for studying lgt1 polymorphisms:

  • Multilocus sequence typing (MLST): B. cereus shows significant genetic diversity, with studies identifying 192 different sequence types (STs) among 368 isolates . Correlating lgt1 sequence variants with these STs could reveal patterns of evolution and selection.

  • Structure-function analysis: Map polymorphisms onto protein structure models to predict functional impacts

  • Recombinant expression of variants: Compare enzymatic activity of different natural lgt1 variants in standardized assays

  • Complementation studies: Introduce different lgt1 variants into deletion mutants to assess their relative capacity to restore wild-type phenotypes

This research direction could help explain the varying levels of virulence observed among B. cereus strains and potentially identify high-risk variants for enhanced surveillance.

What interactions exist between lgt1 and toxin production systems in B. cereus?

The interactions between lgt1 and toxin production systems in B. cereus reveal complex regulatory networks:

While direct experimental evidence of lgt1-toxin interactions is limited in the search results, we can infer potential relationships based on known B. cereus toxin systems:

Diarrheal toxin interactions:

  • The widespread distribution of enterotoxin genes in B. cereus isolates (nheABC in 83%, hblACD in 39%, cytK in 68%, and entFM in 100% of strains) suggests these systems are fundamental to virulence

  • Lipoproteins processed by lgt1 may function in sensing environmental cues that trigger enterotoxin production

  • Toxin secretion pathways might include lipoprotein components requiring lgt1 processing

Emetic toxin interactions:

  • The emetic toxin cereulide (encoded by cesB) is found in only 7% of B. cereus strains , suggesting a more specialized virulence mechanism

  • ST26 strains frequently harbor the cesB gene and are associated with food poisoning causing vomiting

  • Lipoproteins might contribute to regulating cereulide production in response to specific food components, particularly starch-containing foods

These interactions represent promising research targets for understanding B. cereus pathogenicity and developing intervention strategies for food safety applications.

How do I resolve common challenges in recombinant lgt1 expression and purification?

Recombinant lgt1 expression and purification present several challenges due to the enzyme's membrane association. Here are systematic approaches to overcome common issues:

Expression challenges and solutions:

ChallengeSolution Approach
Poor solubility1. Use membrane protein expression vectors with solubility tags (MBP, SUMO)
2. Express in specialized E. coli strains (C41/C43) designed for membrane proteins
3. Reduce induction temperature to 16-20°C and extend expression time
Protein misfolding1. Co-express with molecular chaperones (GroEL/ES, DnaK/J)
2. Include mild detergents in lysis buffer (0.5-1% Triton X-100)
3. Test various buffer compositions to enhance stability
Low yield1. Optimize codon usage for expression host
2. Test different promoter systems (T7, tac, araBAD)
3. Scale up culture volume with optimized conditions

Purification strategies:

  • Two-step purification combining affinity chromatography with size exclusion or ion exchange

  • Incorporate appropriate detergents (DDM, LDAO) throughout purification to maintain native conformation

  • Add glycerol (10-20%) to all buffers to enhance protein stability

  • Include reducing agents to prevent disulfide-mediated aggregation

  • Validate activity after each purification step to ensure enzyme functionality

This methodical approach helps overcome the inherent challenges of working with membrane-associated enzymes like lgt1, maximizing the chances of obtaining functional protein for downstream analyses.

What approaches can help analyze contradictory results in lgt1 functional studies?

Analyzing contradictory results in lgt1 functional studies requires systematic investigation of experimental variables:

Systematic troubleshooting approach:

  • Genetic background verification:

    • Confirm strain identity using multilocus sequence typing (MLST) to identify specific sequence types (STs)

    • Verify gene deletion/complementation by sequencing

    • Check for compensatory mutations that might mask phenotypes

  • Methodological considerations:

    • Compare experimental designs across studies using the framework from experimental design principles

    • Evaluate differences in:

      • Growth conditions (media, temperature, aeration)

      • Assay sensitivity and specificity

      • Sample preparation techniques

  • Variable phenotype explanations:

    • Consider strain-specific genetic context effects

    • Investigate threshold effects in lipoprotein processing

    • Examine potential functional redundancy with other enzymes

  • Resolution strategies:

    • Design critical experiments addressing specific contradictions

    • Perform side-by-side comparisons under identical conditions

    • Implement multiple complementary assays to measure the same parameter

    • Collaborate with laboratories reporting contradictory results for direct comparison

This structured approach can identify the sources of contradictory results and establish consensus on lgt1 function across different experimental contexts.

How can I quantitatively analyze lgt1 enzymatic activity in different experimental conditions?

Quantitative analysis of lgt1 enzymatic activity requires rigorous assay design and careful data interpretation:

In vitro enzymatic assays:

  • Radiometric assay: Measure incorporation of radiolabeled lipids (e.g., 14C-palmitate) into substrate proteins

    • Quantify using scintillation counting or phosphorimaging

    • Calculate specific activity (nmol product/min/mg enzyme)

  • Fluorescence-based assay: Use fluorescently labeled substrate analogs

    • Monitor real-time kinetics through fluorescence changes

    • Determine Km, Vmax, and catalytic efficiency (kcat/Km)

  • Mass spectrometry approach: Detect mass shifts corresponding to diacylglyceryl addition

    • Provides direct evidence of substrate modification

    • Can be quantitative when using internal standards

Data analysis framework:

  • Apply appropriate statistical methods for comparing activity under different conditions:

    • ANOVA for multiple condition comparisons

    • Linear regression for examining correlations with experimental variables

    • Non-linear regression for enzyme kinetics modeling

  • Control for confounding variables:

    • Substrate availability and concentration

    • Membrane/detergent composition effects

    • Enzyme stability over assay duration

This comprehensive approach enables reliable quantification of lgt1 activity across diverse experimental conditions, facilitating mechanistic insights and structure-function relationships.

What bioinformatic tools are most useful for studying lgt1 sequence conservation and function prediction?

Bioinformatic analysis of lgt1 provides valuable insights into conservation and function:

Sequence analysis tools:

  • Multiple sequence alignment:

    • MUSCLE or Clustal Omega for aligning lgt1 sequences across Bacillus species

    • Jalview for visualization and conservation analysis

    • Identification of invariant catalytic residues and substrate-binding motifs

  • Phylogenetic analysis:

    • MEGA or RAxML for constructing phylogenetic trees

    • Correlation with MLST data to examine evolutionary relationships

    • PHYLOViZ for visualizing minimum spanning trees as used for B. cereus MLST analysis

  • Structure prediction:

    • AlphaFold or RoseTTAFold for generating structural models

    • SWISS-MODEL for homology modeling if related structures exist

    • Molecular dynamics simulations to predict functional motions

Functional annotation tools:

  • Domain identification:

    • InterProScan to identify conserved domains and motifs

    • Pfam for family classification and functional annotation

  • Genomic context analysis:

    • MicrobesOnline or STRING for examining gene neighborhoods

    • Identification of potential functional partners through co-occurrence patterns

  • Virulence prediction:

    • VirulenceFinder or VFDB for comparing to known virulence factors

    • Correlation with clinical isolate data to identify pathogenicity-associated variants

These bioinformatic approaches complement experimental studies and can guide hypothesis generation for further functional characterization of lgt1.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.