Recombinant Bacillus cereus Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Bacillus cereus prolipoprotein diacylglyceryl transferase (Lgt) is a genetically engineered enzyme responsible for catalyzing the first step in bacterial lipoprotein biosynthesis. Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the cysteine residue within the conserved lipobox motif of prolipoproteins, enabling their anchorage to cell membranes . This post-translational modification is critical for membrane localization and functionality of lipoproteins, which are essential for bacterial virulence, nutrient uptake, and stress adaptation .

Mechanism of Action

Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to prolipoproteins, forming a thioether bond at the conserved cysteine residue . This step is indispensable for subsequent processing by signal peptidase II (LspA) and membrane anchoring .

Role in Bacterial Physiology

  • Virulence: In Bacillus anthracis (a close relative of B. cereus), Lgt-deficient mutants showed attenuated spore germination in vitro and reduced TLR2-mediated immune responses, leading to decreased virulence in murine models .

  • Membrane Integrity: Lgt activity maintains outer membrane stability in Gram-negative bacteria (e.g., Escherichia coli), with Lgt depletion increasing antibiotic sensitivity .

Comparative Analysis of Lgt Across Species

SpeciesFunctionEssentialityKey Observations
Bacillus cereusLipoprotein anchoringNon-essential for growthRecombinant Lgt retains enzymatic activity .
Escherichia coliMembrane stability, virulenceEssentialCrystal structure resolved at 1.6–1.9 Å .
Bacillus anthracisSpore germination, immune evasionCritical for virulenceΔlgt mutants show 100-fold attenuation in murine models .

Inhibitor Studies

  • Lgt Inhibitors: Novel macrocyclic compounds (e.g., G2823, G2824) inhibit Lgt activity in vitro and exhibit bactericidal effects against E. coli and Acinetobacter baumannii .

  • CRISPRi Validation: Downregulation of lgt via CRISPR interference sensitizes bacteria to Lgt-targeting inhibitors .

Antibiotic Development

Lgt is a promising target for novel antibiotics due to its essential role in lipoprotein biogenesis and absence in humans . Inhibitors like G2823 disrupt membrane integrity, bypassing resistance mechanisms associated with downstream lipoprotein transporters (e.g., Lpp) .

Biotechnological Engineering

Recombinant Lgt enables site-specific lipid modification of proteins for synthetic biology applications, such as engineered liposomes or vaccine adjuvants .

Challenges and Future Directions

  • Structural Resolution: Full-length B. cereus Lgt structures are needed to elucidate species-specific catalytic nuances.

  • In Vivo Efficacy: Current inhibitors require optimization for Gram-positive pathogens like B. cereus.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference for your use.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is defined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
lgt; BCE33L4855; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bacillus cereus (strain ZK / E33L)
Target Names
lgt
Target Protein Sequence
MLLGSVPQLDRVAVQLGPFPVYWYGIIIGTGVLLGLWLATREGERLGIPKDTFVDLVLIA VPIAILFARMYYVIFEWEYYAQNPSQIINIRQGGLAIHGGLIGAVITGILFAKRRGVSFW KLADIAAPSILLGQAIGRWGNFMNQEAHGDEVTRQFLEGLHLPDFIINQMYIDGVYYHPT FLYESLWNFAGVILLLALRKVNLRRGELFFTYLIWYSIGRFFVEGLRTDSLMLGPLRIAQ VMSIGLVVISIIFIIVRRKMGQADKRYSEN
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, representing the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Lgt in bacterial membranes?

Lgt (prolipoprotein phosphatidylglycerol diacylglyceryl transferase) catalyzes the first and committed step in the bacterial lipoprotein modification pathway. It transfers a diacylglyceryl (DAG) moiety from phosphatidylglycerol onto the cysteine residue within the lipobox motif of a preprolipoprotein, resulting in a thioether-linked prolipoprotein. This modification is crucial for bacterial envelope integrity as it provides initial membrane anchoring for lipoproteins. The lipid modification pathway continues with signal peptidase II (Lsp) cleaving the signal peptide, followed by apolipoprotein N-acyltransferase (Lnt) transferring a fatty acid from phosphatidylethanolamine in some bacteria, resulting in a triacylated mature lipoprotein . Lgt is evolutionarily conserved across all bacteria but notably absent from archaea, highlighting its specificity to bacterial systems .

How does the structure of Lgt relate to its function?

Lgt features a complex membrane protein structure with several transmembrane helices organized into functional domains including the arm domain and head domain. AlphaFold structural models demonstrate that Lgt structures are similar to the X-ray structure of Lgt from E. coli, with most variability observed in the arm and head domains, which contain less conserved residues . The enzyme contains a central cavity where catalysis occurs, with a highly conserved His103-Gly-Gly-Leu106 motif (in E. coli Lgt) located in a side cleft between major and minor transmembrane helix domains . This catalytic center facilitates binding of the phospholipid substrate and activation of the thiol group in the lipobox cysteine. The periplasmic head domain has been demonstrated to be important for Lgt function through complementation studies .

Why is Lgt considered a promising antibiotic target?

Lgt represents an excellent antibiotic target candidate for several compelling reasons. First, it is essential for cell viability in proteobacteria, making it a critical enzyme that bacteria cannot function without . Second, its membrane localization and relative accessibility to small molecules make it more easily targetable compared to cytoplasmic proteins . Third, Lgt is highly conserved across pathogenic bacterial species but absent in archaea and eukaryotes, offering potential for selective targeting without affecting human cells . Finally, as the enzyme catalyzing the first committed step in the lipoprotein modification pathway, inhibiting Lgt would prevent the proper localization and function of numerous bacterial lipoproteins that play crucial roles in cell envelope integrity, nutrient acquisition, and virulence .

What are the optimal conditions for recombinant expression of B. cereus Lgt?

For optimal recombinant expression of B. cereus Lgt, researchers should consider a dual approach integrating codon optimization and expression system selection. Given that Lgt is a membrane protein with multiple transmembrane helices, expression systems such as E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein overexpression are recommended. Based on studies with other bacterial Lgt proteins, expression should be conducted at lower temperatures (16-18°C) following induction with reduced IPTG concentrations (0.1-0.5 mM) to prevent aggregation and inclusion body formation . Careful consideration should be given to potential toxicity issues, as functional studies have shown that Lgt from firmicutes (like B. cereus) does not complement Lgt function in proteobacteria, suggesting potential incompatibility in heterologous expression systems . Researchers may need to incorporate solubility-enhancing fusion tags (such as MBP or SUMO) and optimize growth media with supplements like glycerol (0.4-0.5%) to improve membrane protein folding.

What challenges are specific to purifying B. cereus Lgt and how can they be addressed?

Purification of B. cereus Lgt presents several membrane protein-specific challenges that require methodological consideration. First, selection of appropriate detergents is critical - initial screening should include mild detergents like DDM, LMNG, or CHAPS at concentrations slightly above their critical micelle concentration to effectively solubilize Lgt without denaturation. Second, researchers should implement a two-step purification strategy combining affinity chromatography (typically His-tag based) followed by size exclusion chromatography to separate properly folded protein from aggregates . Third, maintaining enzyme stability during purification requires buffer optimization with appropriate pH (typically 7.5-8.0), salt concentration (typically 150-300 mM NaCl), and glycerol (10-20%) to prevent aggregation. Finally, activity assays should be performed at each purification step to ensure retention of enzymatic function, as structural studies have shown that alterations in the arm and head domains can significantly impact Lgt activity .

How can I verify that recombinantly expressed B. cereus Lgt is properly folded and functional?

Verifying proper folding and functionality of recombinant B. cereus Lgt requires a multi-faceted approach. First, implement a luciferase-coupled assay that exploits Lgt's ability to use phosphatidylglycerol with racemic terminal glycerol at C2 as a substrate, producing glycerol-3-phosphate which can be detected through coupled enzymatic reactions . Second, conduct circular dichroism spectroscopy to confirm the presence of expected secondary structure elements characteristic of membrane proteins. Third, perform thermal shift assays to assess protein stability, with properly folded protein showing a cooperative unfolding curve. Fourth, examine size exclusion chromatography profiles to confirm monodispersity, as aggregated protein typically elutes in the void volume. Finally, consider complementation studies in a heterologous system, though noting the limitation that B. cereus Lgt (as a firmicute) may not functionally replace E. coli Lgt . The presence of conserved residues such as Y26, H103, R143, N146, G154, and R239 (E. coli numbering) should be verified, as these have been demonstrated to be essential for Lgt function .

What assays can be used to measure B. cereus Lgt enzyme activity in vitro?

Several sophisticated assays can be employed to measure B. cereus Lgt activity in vitro. The most recent advancement is a luciferase-coupled assay exploiting Lgt's ability to use phosphatidylglycerol as a substrate, producing glycerol-1-phosphate or glycerol-3-phosphate as products. This assay couples the production of glycerol-3-phosphate to a luminescence readout, providing a sensitive and high-throughput detection method . Alternatively, researchers can use radiolabeled substrates such as [14C]- or [3H]-labeled phosphatidylglycerol to directly track the transfer of diacylglyceryl moieties to synthetic peptide substrates containing the lipobox motif. For greater precision, mass spectrometry-based assays can be implemented to detect the mass shift associated with diacylglyceryl addition to the substrate peptide. When comparing Lgt activity across species, it's important to normalize enzyme concentrations and account for potential differences in substrate specificity, as studies have shown that Lgt from different bacterial phyla may have varying preferences for phospholipid substrates .

How can I design site-directed mutagenesis experiments to investigate the catalytic mechanism of B. cereus Lgt?

Design of site-directed mutagenesis experiments for B. cereus Lgt should focus on conserved residues identified through sequence alignments and structural studies. Based on research with E. coli Lgt, primary targets should include the catalytic His103 residue, which can be mutated to asparagine or glutamine to test its proposed role in abstracting a proton from the thiol group of the lipobox cysteine . Additional essential residues for mutagenesis include Y26 (in TM-1), R143 and N146 (in TM-4), G154 (in the loop between TM-4 and head domain), and R239 (in TM-6), as these have been demonstrated to be critical for Lgt function in E. coli . Mutations should be designed as conservative substitutions (e.g., histidine to glutamine) to specifically test catalytic roles rather than structural ones. When designing experiments, researchers should include both functional complementation assays (if possible) and in vitro activity measurements using the purified mutant proteins, comparing kinetic parameters (kcat and KM) between wild-type and mutant enzymes to quantify the impact of each mutation on catalytic efficiency and substrate binding .

What approaches can be used to study the interaction between B. cereus Lgt and its lipoprotein substrates?

Multiple sophisticated approaches can be employed to study B. cereus Lgt-substrate interactions. Molecular dynamics simulations, similar to those conducted with E. coli Lgt, can model the interaction between the enzyme and peptide mimetics of the signal sequence and lipobox motif, providing insights into binding modes and conformational changes during catalysis . Structural biology approaches including X-ray crystallography attempts with substrate analogs or cryo-EM studies of the enzyme-substrate complex would provide direct visualization of binding interactions. Chemical cross-linking coupled with mass spectrometry can identify residues at the interaction interface between Lgt and its substrates. For in vitro characterization, surface plasmon resonance or isothermal titration calorimetry can quantify binding affinities and thermodynamic parameters of the interaction. Researchers should also consider using computational tools like ColabFold or AlphaFold2 to model Lgt complexed with various lipoprotein substrates from B. cereus, which has successfully predicted interactions between E. coli Lgt and its native substrates .

What is the proposed catalytic mechanism of Lgt and how might it differ in B. cereus?

The proposed catalytic mechanism for Lgt involves several coordinated steps centered around the highly conserved His103 residue (in E. coli numbering). First, His103 functions as a catalytic base to abstract a proton from the thiol group of the lipobox cysteine on the preprolipoprotein substrate, generating a reactive thiolate nucleophile. Second, this nucleophile attacks the ester bond connecting the phosphate and diacylglyceryl moiety of the phosphatidylglycerol substrate. Third, this nucleophilic attack results in the formation of a thioether link between the cysteine and the diacylglyceryl group, while simultaneously releasing glycerol-1-phosphate as a byproduct . While the core catalytic residues are highly conserved across bacterial species, B. cereus Lgt might exhibit subtle differences in substrate recognition and binding due to variations in the arm and head domains, which show less sequence conservation across species. These differences could affect the precise positioning of substrates in the active site or the efficiency of catalysis under different conditions .

How do the arm and head domains contribute to Lgt function in B. cereus?

The arm and head domains of Lgt play crucial roles in enzyme function through multiple mechanisms. Structural and functional analyses have demonstrated that these domains show the greatest variability among Lgt homologs from different bacterial species, suggesting species-specific adaptations . The head domain, which extends into the periplasmic space, has been directly implicated in Lgt function through complementation studies where modifications to this domain significantly impaired enzymatic activity. Specifically, chimeric constructs with replaced head domains (Lgt-HeadMt and Lgt-HeadSa) showed impaired growth restoration in Lgt-depleted E. coli strains, with observations of cell filamentation and lysis indicating compromised function . The arm domain likely contributes to substrate recognition and binding, positioning the preprolipoprotein substrate correctly relative to the catalytic site. In B. cereus Lgt, these domains would similarly coordinate substrate recognition and catalysis, though with adaptations specific to B. cereus lipoproteins. The reduced sequence conservation in these domains may explain why Lgt from firmicutes (like B. cereus) cannot functionally complement Lgt in proteobacteria .

What structural models or predictions exist for substrate binding to Lgt?

Multiple structural models have been proposed for substrate binding to Lgt, informed by X-ray crystallography, molecular dynamics simulations, and AI-powered structure predictions. One model, based on molecular dynamics simulations, suggests that the preprolipoprotein substrate initially docks at the front cleft of the enzyme, away from the catalytic histidine, then moves into the active site through a series of conformational changes that include opening a periplasmic gate formed by a loop between TMH6 and TMH7 . This movement brings the lipobox cysteine within 4.0 ± 0.5 Å of the catalytic His103 and 3.5 ± 0.3 Å from the reactive ester bond of the phosphatidylglycerol substrate . Alternative binding modes have been explored using ColabFold and AlphaFold2 structure predictions, which consistently model signal peptides binding at the front cleft of E. coli Lgt . These predictions reveal interesting structural differences from crystal structures, particularly in TMH7 conformation and the periplasmic loop gate positioning, suggesting these elements may undergo significant conformational changes during catalysis. The predicted "open" and experimentally observed "closed" conformations potentially represent different stages of the catalytic cycle .

What evidence supports targeting B. cereus Lgt for antimicrobial development?

Multiple lines of evidence support targeting B. cereus Lgt for antimicrobial development. First, evolutionary analysis demonstrates that Lgt is present in all bacteria, including B. cereus, but absent from archaea and eukaryotes, making it a bacteria-specific target that minimizes off-target effects in humans . Second, the enzyme's membrane localization provides relatively easier access for small molecule inhibitors compared to cytoplasmic targets . Third, while Lgt essentiality varies across bacterial phyla, it plays critical roles in bacterial physiology and is often required for virulence even in species where it is not strictly essential for viability . Fourth, as the enzyme catalyzing the first committed step in lipoprotein modification, inhibiting Lgt would prevent proper processing and localization of numerous lipoproteins involved in various cellular processes including nutrient acquisition, cell envelope integrity, and virulence . Finally, the conserved catalytic mechanism centered around the His103 residue provides a defined molecular target for rational drug design approaches .

How can structural information about Lgt be used for rational inhibitor design?

Structural information about Lgt provides multiple avenues for rational inhibitor design. Researchers should focus on targeting the catalytic center containing the conserved His103 residue, which is critical for enzyme function as demonstrated by mutagenesis studies showing that H103N or H103Q mutations inactivate the enzyme . The central cavity where catalysis occurs offers a defined binding pocket for small molecule inhibitors. Additionally, the front and side clefts involved in substrate entry and product exit represent potential sites for allosteric inhibitors that could block conformational changes required for catalysis . Molecular dynamics simulations have revealed a periplasmic gate formed by a loop between TMH6 and TMH7 that undergoes opening and closing during the catalytic cycle - compounds that stabilize the closed conformation could prevent substrate access to the active site . When designing Lgt inhibitors, researchers should consider the structural differences between Lgt proteins from different bacterial phyla, particularly in the arm and head domains, which could enable development of narrow-spectrum antibiotics targeting specific bacterial groups .

What screening methodologies are most appropriate for identifying B. cereus Lgt inhibitors?

Multiple screening methodologies can be effectively employed to identify B. cereus Lgt inhibitors. High-throughput biochemical assays using the luciferase-coupled detection system that measures glycerol-3-phosphate production would provide a sensitive and scalable primary screening approach . This should be combined with counter-screening against structurally related enzymes to ensure selectivity. Fragment-based screening approaches are particularly suitable given the well-defined catalytic site of Lgt, allowing the identification of chemical scaffolds that can be optimized for potency and selectivity. Structure-based virtual screening utilizing docking simulations against the binding pocket surrounding His103 and other conserved catalytic residues can prioritize compounds for experimental validation. Cell-based secondary assays measuring growth inhibition or accumulation of unprocessed prelipoproteins would confirm on-target activity in whole cells. For more advanced approaches, researchers could implement time-resolved crystallography or HDX-MS (hydrogen-deuterium exchange mass spectrometry) to visualize inhibitor binding modes and induced conformational changes in the enzyme .

How does B. cereus Lgt compare to Lgt from other bacterial species?

B. cereus Lgt, as a member of the firmicutes phylum, shows significant differences from proteobacterial Lgt enzymes that impact functional interchangeability while maintaining the core catalytic mechanism. Comprehensive evolutionary analysis has demonstrated that while the catalytic center containing residues like His103 is highly conserved across all bacteria, the arm and head domains show considerable variability between different bacterial phyla . Functional complementation studies have clearly demonstrated that Lgt from firmicutes (including close relatives of B. cereus such as S. aureus, E. faecalis, and S. agalactiae) cannot restore growth and viability when expressed in Lgt-depleted E. coli strains, whereas Lgt from proteobacteria successfully complement each other . These functional differences likely arise from species-specific adaptations in substrate recognition and processing, particularly in the variable arm and head domains. AlphaFold structural models confirm that most structural variability and less conserved residues are located in these regions across bacterial species .

What functional differences exist between Lgt in Gram-positive versus Gram-negative bacteria?

Significant functional differences exist between Lgt in Gram-positive bacteria (like B. cereus) and Gram-negative bacteria. The most striking difference is in essentiality - Lgt is absolutely essential for viability in most Gram-negative bacteria (proteobacteria), whereas in many Gram-positive bacteria (firmicutes), it is often non-essential for growth but required for full virulence . This differential essentiality likely reflects fundamental differences in cell envelope architecture and the roles that lipoproteins play in each bacterial group. The lipoprotein modification pathway shows variations between these groups: while the first two steps (catalyzed by Lgt and Lsp) are largely consistent across bacteria, the third step varies considerably, with Lnt being essential in γ-proteobacteria but not in other bacterial groups . Complementation studies have convincingly demonstrated that Lgt from firmicutes (Gram-positive) cannot functionally replace Lgt in proteobacteria (Gram-negative), indicating substantial differences in substrate recognition, processing mechanisms, or interactions with other components of the lipoprotein processing machinery .

What experimental approaches can determine if insights from E. coli Lgt studies apply to B. cereus Lgt?

Several experimental approaches can determine the applicability of E. coli Lgt insights to B. cereus Lgt. First, site-directed mutagenesis of conserved residues identified in E. coli Lgt (such as Y26, H103, R143, N146, G154, and R239) should be performed in B. cereus Lgt to verify if these residues serve identical functions across species . Second, chimeric proteins containing domains swapped between E. coli and B. cereus Lgt can identify which structural elements contribute to species-specific functions, building upon previous work with head domain chimeras . Third, comparative enzymatic assays using identical artificial substrates can quantify differences in catalytic efficiency, substrate preference, and reaction kinetics between the two enzymes. Fourth, structural biology approaches including crystallography or cryo-EM of B. cereus Lgt would enable direct comparison with the solved E. coli Lgt structure. Finally, complementation experiments should be conducted in both directions - not only testing if B. cereus Lgt complements E. coli Lgt deficiency (which existing research suggests it will not), but also whether E. coli Lgt can complement B. cereus Lgt deficiency .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.