Recombinant Bacillus cereus Protein CrcB homolog 2 (crcB2)

What is Recombinant Bacillus cereus Protein CrcB homolog 2 (crcB2)?

Recombinant Bacillus cereus Protein CrcB homolog 2 (crcB2) is a full-length protein (118 amino acids) that functions as a putative fluoride ion transporter. It is also known as camphor resistance protein CrcB and is encoded by the crcB2 gene (UniProt ID: Q631P3). The protein is typically expressed in E. coli with an N-terminal His tag for purification purposes. The complete amino acid sequence is: MIEALLVATGGFFGAITRFAISNWFKKRNKTSFPIATFLINITGAFLLGYIIGSGVTTGWQLLLGTGFMGAFTTFSTFKLESVQLLNRKNFSTFLLYLSATYIVGILFAFLGMQLGGI . This protein belongs to a broader family of CrcB homologs found across various bacterial species, including Bacillus subtilis, Bifidobacterium longum, and Staphylococcus species .

How should Recombinant Bacillus cereus Protein CrcB homolog 2 be stored and reconstituted for experimental use?

For optimal stability, Recombinant Bacillus cereus Protein CrcB homolog 2 is typically supplied as a lyophilized powder and should be stored at -20°C to -80°C upon receipt. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they may compromise protein integrity .

For reconstitution, it is recommended to:

• Briefly centrifuge the vial before opening to bring contents to the bottom

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (typically 50% is standard)

• Aliquot for long-term storage at -20°C to -80°C

The protein is typically reconstituted in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 to maintain stability .

What structural and functional characteristics define Recombinant Bacillus cereus Protein CrcB homolog 2 compared to other CrcB homologs?

Recombinant Bacillus cereus Protein CrcB homolog 2 belongs to a conserved family of membrane proteins found across bacterial species. The CrcB2 protein is characterized by:

• A transmembrane structure with multiple membrane-spanning domains

• Putative fluoride ion transport functionality

• Sequence homology with camphor resistance proteins

While the Bacillus cereus CrcB homolog 2 shares core structural features with homologs from other species like Bacillus subtilis (where it's known as yhdV) and Staphylococcus aureus, subtle species-specific variations exist in the amino acid sequences . These differences may translate to functional variability or substrate specificity across species. Research comparing the fluoride transport efficiency or binding characteristics across different CrcB homologs would provide valuable insights into structure-function relationships.

What are the experimental challenges in studying membrane-associated functions of Recombinant Bacillus cereus Protein CrcB homolog 2?

Investigating the membrane-associated functions of Recombinant Bacillus cereus Protein CrcB homolog 2 presents several experimental challenges:

• Protein solubility and stability: As a membrane protein, CrcB2 may have limited solubility in aqueous solutions without appropriate detergents or lipid environments. Researchers must optimize buffer conditions to maintain protein stability while preserving native conformation.

• Functional reconstitution: Studying ion transport function requires reconstitution into artificial membrane systems such as liposomes or nanodiscs. This process requires careful optimization of protein:lipid ratios and membrane composition.

• Transport assays: Measuring fluoride transport activity demands sensitive detection methods such as fluoride-selective electrodes or fluorescent probes that can detect changes in fluoride concentration across membranes.

• Structural determination: Obtaining high-resolution structural data for membrane proteins like CrcB2 is challenging and may require specialized techniques such as cryo-electron microscopy or X-ray crystallography with lipidic cubic phase crystallization.

To address these challenges, researchers often employ a combination of biochemical, biophysical, and computational approaches to characterize both structural and functional aspects of the protein.

How can protein-protein interaction studies with Recombinant Bacillus cereus Protein CrcB homolog 2 reveal its role in bacterial physiology?

Protein-protein interaction studies with Recombinant Bacillus cereus Protein CrcB homolog 2 can provide critical insights into its physiological role through several methodological approaches:

• Co-immunoprecipitation (Co-IP): Using antibodies against the His-tag or CrcB2 protein itself to pull down interaction partners from bacterial lysates, followed by mass spectrometry identification.

• Yeast two-hybrid (Y2H) screening: Creating fusion constructs with CrcB2 to identify interacting proteins from genomic libraries of Bacillus cereus.

• Proximity-based labeling: Techniques such as BioID or APEX2 tagging of CrcB2 to identify proteins in close proximity within the native cellular environment.

• Surface plasmon resonance (SPR): Quantitative measurement of binding kinetics between purified CrcB2 and candidate interacting proteins.

• Bacterial two-hybrid systems: Specialized for membrane protein interactions in bacterial hosts.

These approaches can reveal connections to stress response pathways, ion homeostasis mechanisms, or unexpected functional roles beyond the annotated fluoride transport function. Comparative interaction networks across different growth conditions or stress stimuli can further elucidate the dynamic role of CrcB2 in bacterial adaptation and survival.

What purification strategies yield the highest purity and activity for Recombinant Bacillus cereus Protein CrcB homolog 2?

Optimizing purification protocols for Recombinant Bacillus cereus Protein CrcB homolog 2 requires balancing yield, purity, and retention of functional activity. The following methodological approach has been shown to produce high-quality protein:

• Expression optimization:

  • Use BL21(DE3) or other E. coli expression strains optimized for membrane proteins

  • Induce with lower IPTG concentrations (0.1-0.5 mM) at reduced temperatures (16-25°C)

  • Consider auto-induction media for higher yields

• Extraction and solubilization:

  • Use mild detergents such as n-dodecyl-β-D-maltoside (DDM) or CHAPS

  • Include protease inhibitors and reducing agents

  • Optimize detergent:protein ratios to prevent aggregation

• Multi-step purification:

  • Initial purification using Immobilized Metal Affinity Chromatography (IMAC) with the N-terminal His-tag

  • Secondary purification via size exclusion chromatography

  • Optional ion exchange chromatography for higher purity

Current protocols typically achieve purity levels of ≥85-90% as determined by SDS-PAGE analysis . Higher purity (>95%) may be required for structural studies or specific biochemical assays.

How can researchers assess the functional activity of purified Recombinant Bacillus cereus Protein CrcB homolog 2?

Assessing the functional activity of purified CrcB2 requires methods that can measure its putative fluoride ion transport capability:

• Liposome-based fluoride transport assays:

  • Reconstitute purified CrcB2 into liposomes

  • Load liposomes with a fluoride-sensitive fluorescent dye

  • Monitor fluorescence changes upon addition of external fluoride

  • Compare transport rates with appropriate controls (empty liposomes, heat-inactivated protein)

• Electrophysiological approaches:

  • Planar lipid bilayer recordings to measure ion conductance

  • Patch-clamp studies of proteoliposomes or cells expressing CrcB2

• Binding assays:

  • Isothermal titration calorimetry (ITC) to measure fluoride binding parameters

  • Microscale thermophoresis (MST) to detect binding-induced changes in thermophoretic mobility

• Functional complementation:

  • Express CrcB2 in fluoride-sensitive bacterial strains lacking endogenous fluoride transporters

  • Assess growth rescue in presence of fluoride stress

These methodological approaches should include appropriate positive and negative controls, and results should be validated using multiple techniques to ensure robust functional characterization.

What are the recommended experimental designs for studying the role of Recombinant Bacillus cereus Protein CrcB homolog 2 in fluoride resistance?

To investigate the role of CrcB2 in fluoride resistance, researchers should consider the following experimental design approach:

• Gene knockout and complementation studies:

  • Generate crcB2 deletion mutants in Bacillus cereus

  • Complement with wild-type and mutated versions of the gene

  • Assess fluoride sensitivity through growth inhibition assays

• Dose-response measurements:

  • Determine minimum inhibitory concentrations (MICs) of fluoride for wild-type and mutant strains

  • Generate complete growth curves at various fluoride concentrations

  • Calculate EC50 values for fluoride toxicity

• Intracellular fluoride measurements:

  • Use fluoride-sensitive probes to measure intracellular fluoride accumulation

  • Compare fluoride levels between wild-type, knockout, and complemented strains

• Transcriptional response analysis:

  • RNA-seq or qRT-PCR to measure expression changes of crcB2 under fluoride stress

  • Identify co-regulated genes and potential regulatory networks

• Protein localization studies:

  • Fluorescent protein fusions to confirm membrane localization

  • Immunogold electron microscopy for precise subcellular localization

A comprehensive experimental approach combining these methods provides robust evidence for the specific role of CrcB2 in fluoride homeostasis and resistance in Bacillus cereus.

How does Recombinant Bacillus cereus Protein CrcB homolog 2 compare to CrcB proteins from other bacterial species?

Recombinant Bacillus cereus Protein CrcB homolog 2 shares structural and functional similarities with CrcB homologs from other bacterial species, but also exhibits distinctive characteristics:

Comparative studies suggest that while the core structure and function of CrcB proteins are conserved across species, variations in amino acid sequences may confer species-specific adaptations related to substrate specificity, transport efficiency, or regulatory mechanisms. Phylogenetic analysis combined with functional studies across these species can provide insights into the evolutionary development of this protein family.

What experimental systems are most appropriate for studying the pathogenic relevance of Recombinant Bacillus cereus Protein CrcB homolog 2?

To investigate the potential role of CrcB2 in Bacillus cereus pathogenicity, researchers should consider several experimental systems:

• In vitro cellular models:

  • Human retinal pigment epithelial (RPE) cell lines to study blood-retina barrier interactions

  • Tight junction permeability assays using transwell systems

  • Measurement of inflammatory cytokine production (IL-6, MIP-1α, IL-1β, KC)

• Ex vivo tissue models:

  • Retinal explant cultures to assess tissue-level responses

  • Barrier function testing with fluorescent tracers

• Animal models:

  • Mouse models of B. cereus endophthalmitis as described in previous research

  • Assessment of blood-retina barrier permeability

  • Evaluation of tight junction protein disruption (ZO-1, occludin)

• Comparative virulence studies:

  • Wild-type vs. crcB2 knockout strains in infection models

  • Complementation with recombinant CrcB2 to confirm phenotypes

• Bacterial survival assays:

  • Fluoride challenge in host-relevant conditions

  • Intracellular survival within host cells

While B. cereus can cause severe endophthalmitis with blood-retina barrier disruption , the specific contribution of CrcB2 to this process requires targeted investigation using these experimental approaches.

What bioinformatic approaches can reveal functional insights about Recombinant Bacillus cereus Protein CrcB homolog 2?

Computational analysis can provide valuable functional predictions about CrcB2 through several approaches:

• Sequence-based analysis:

  • Multiple sequence alignment with homologs to identify conserved residues

  • Domain prediction to identify functional motifs

  • Transmembrane topology prediction using algorithms like TMHMM or Phobius

• Structural prediction:

  • Homology modeling based on related structures

  • Ab initio modeling using programs like AlphaFold2 or RoseTTAFold

  • Molecular dynamics simulations to assess conformational dynamics

• Protein-protein interaction networks:

  • Text mining of literature for reported interactions

  • Prediction of interaction partners based on co-expression data

  • Structural docking with candidate interacting proteins

• Genomic context analysis:

  • Examination of gene neighborhood conservation

  • Identification of co-regulated genes in operons

  • Comparative genomics across multiple Bacillus species

• Data integration:

  • Synthesis of proteomic, transcriptomic, and metabolomic data

  • Pathway mapping to identify biological processes involving CrcB2

These computational approaches can generate testable hypotheses about CrcB2 function, regulatory mechanisms, and potential roles in bacterial physiology beyond the annotated fluoride transport activity.

How should researchers interpret contradictory data when studying Recombinant Bacillus cereus Protein CrcB homolog 2?

When encountering contradictory results in CrcB2 research, a systematic approach to data interpretation is essential:

• Methodological validation:

  • Verify protein identity and purity through mass spectrometry

  • Confirm proper folding and stability using circular dichroism or thermal shift assays

  • Check for potential contaminants or degradation products

• Context-dependent function:

  • Evaluate whether experimental conditions (pH, ion concentration, membrane composition) affect function

  • Consider potential moonlighting functions under different physiological states

  • Test function in native versus heterologous expression systems

• Technical limitations:

  • Assess sensitivity and specificity of detection methods

  • Consider the impact of tags or fusion proteins on function

  • Evaluate whether in vitro conditions adequately mimic the native environment

• Evolutionary considerations:

  • Compare with data from closely related homologs

  • Consider potential functional divergence in Bacillus cereus

• Integrative approach:

  • Combine multiple independent techniques to verify key findings

  • Develop mechanistic models that can explain seemingly contradictory observations

Careful documentation of experimental conditions, controls, and replication strategies is essential for resolving contradictions and building a coherent understanding of CrcB2 function.