Recombinant Bacillus cereus Sensor protein lytS (lytS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard protocol includes 50% glycerol, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please let us know, and we will prioritize developing the specified tag.
Synonyms
lytS; BC_5441; Sensor protein LytS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)
Target Names
lytS
Target Protein Sequence
MLNLVLMMIERVGLIVILGFLLSHIKTFRRLLHKQDGYVDKLKLICIFSVFTIVSNYTGI EIAGNTIMNENWLQGVSSSSTIANTRIMGVGISGLLGGPIVGIGVGSIAGIHRYMLGGTT ALSCAISSILAGVITGYIGYIFKKYNRTITPKFSAILSVFIVSLEMIMILLIVEDGMSIV KTIAIPMILVNSFGSFILLSMIQAILRQEENAKALQTHKVLRIADKTLPYFRQGLTEESC KHVAQIIHRFPGTDAVSLTDTEKILAHVGLASDHHIPSHSLITGLSKEVLHTGQIMKAKS REVINCQHEGCPLQAAIVIPLTSHGNTIGTLKLYFKNPNQLSRVEEELAEGLAKIFSTQL ELGEAELQSKLLQDAEIKALQAQINPHFLFNAINTVSALCRTDVEKARKLLLQLSVYFRC NLQGARQLLIPLEQELNHVQAYLSLEQARFPNKYEVKMYIEDELKTTLVPPFVLQLLVEN ALRHAFPKKQPVCEVEVHVFEKEGMVHFEVKDNGQGIEEERLEQLGKMVVSSKKGTGTAL YNINERLIGLFGKETMLHIESELNEGTEITFVIPKKVGEEEQIVKSISS
Uniprot No.

Target Background

Function
LytS is a member of the two-component regulatory system LytS/LytT, which likely regulates genes involved in cell wall metabolism.
Database Links

KEGG: bce:BC5441

STRING: 226900.BC5441

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the LytS protein in Bacillus cereus and what role does it play in bacterial physiology?

LytS is a sensor histidine kinase that functions as part of a two-component regulatory system in Bacillus cereus. Similar to characterized systems in related Bacillus species, LytS likely works in conjunction with a response regulator (typically LytR) to control cell wall metabolism, autolysis, and potentially virulence mechanisms. The protein contains transmembrane domains that sense environmental changes and a cytoplasmic kinase domain that initiates phosphorylation cascades in response to stimuli. The LytS/LytR system appears to be conserved across many Bacillus species, though with variable conservation between strains, similar to what has been observed with other regulatory proteins in B. cereus . Understanding this protein is critical for researchers investigating bacterial regulatory networks, particularly those involved in cell wall maintenance and potential antibiotic resistance mechanisms.

How does the genomic context of the lytS gene inform its function in B. cereus?

When analyzing the genomic context of regulatory genes like lytS in B. cereus, researchers should examine neighboring genes that may provide functional insights. Similar to what was observed with the LysBC17 endopeptidase gene in B. cereus strain Bc17, where neighboring genes were associated with antibiotic and metal resistance , the genomic neighborhood of lytS may reveal functional relationships. A thorough genomic analysis should determine whether lytS is part of an operon, examine conservation across B. cereus strains, and identify proximal genes involved in cell wall metabolism, stress response, or virulence. For example, in the B. cereus ATCC 14579 genome, certain peptidase genes were found to be present in some strains but absent in others . Similar variability analysis for lytS would help researchers understand strain-specific adaptations and functional importance.

What structural domains characterize the LytS protein and how do they relate to its sensing function?

The LytS protein typically contains several key structural domains that are essential to its function as a sensor histidine kinase. These include:

  • N-terminal transmembrane sensing domains (typically 5-6 transmembrane helices)

  • HAMP domain (present in Histidine kinases, Adenylyl cyclases, Methyl-accepting proteins, and Phosphatases)

  • Dimerization and histidine phosphotransfer (DHp) domain

  • Catalytic and ATP-binding (CA) domain

When characterizing recombinant LytS, researchers should use bioinformatic tools to predict these domains, similar to the analysis performed for other B. cereus proteins where SignalP was used to determine the absence of signal peptides . The transmembrane domains are particularly important for sensing cell envelope stress, potentially including peptidoglycan disruption. For functional analysis, site-directed mutagenesis of conserved residues (particularly the phosphorylated histidine in the DHp domain) can help establish structure-function relationships. Protein modeling approaches can further elucidate how conformational changes upon sensing propagate to the kinase domain.

What are the optimal expression systems for producing recombinant B. cereus LytS protein?

For successful expression of recombinant B. cereus LytS protein, researchers should consider several expression systems and optimization strategies:

E. coli Expression Systems:

  • BL21(DE3) strain is commonly used for recombinant protein expression from Bacillus species, as was successfully used for LysBC17 endopeptidase

  • For membrane proteins like LytS, specialized strains like C41(DE3) or C43(DE3) may improve yields

  • Expression vectors with tunable promoters (e.g., T7lac or araBAD) allow control of expression intensity

Expression Optimization:

  • Temperature: Lower temperatures (16-25°C) often improve folding of complex proteins

  • Inducer concentration: Titrate IPTG (0.1-1.0 mM) or arabinose concentrations

  • Expression time: Test different induction periods (4-24 hours)

  • Media supplements: Addition of glycylglycine or sorbitol can improve protein stability

For the challenging expression of membrane proteins like LytS, researchers may need to express truncated versions containing just the cytoplasmic domains, or utilize fusion partners like MBP or SUMO to improve solubility. Alternatively, cell-free expression systems can be employed when conventional methods yield insufficient protein.

What purification strategies are most effective for obtaining high-purity recombinant LytS protein?

Purifying recombinant LytS requires tailored strategies depending on whether the full-length membrane protein or only cytoplasmic domains are expressed:

For Full-Length LytS:

  • Membrane isolation: Following cell lysis, separate membranes by ultracentrifugation

  • Detergent solubilization: Screen detergents (DDM, LMNG, CHAPS) for optimal extraction

  • Affinity chromatography: Utilize His-tag or other fusion tags for initial capture

  • Size exclusion chromatography: Remove aggregates and achieve final polishing

For Cytoplasmic Domains:

  • Affinity chromatography: IMAC using nickel or cobalt resins for His-tagged constructs

  • Ion exchange chromatography: Based on predicted isoelectric point

  • Size exclusion chromatography: Final polishing step

A multi-step purification approach is essential, as demonstrated for other B. cereus proteins where recombinant proteins were expressed and purified from E. coli using affinity chromatography followed by additional purification steps . Researchers should monitor protein purity at each step using SDS-PAGE and assess activity through functional assays. For membrane proteins, detergent screening is critical as the choice of detergent significantly impacts stability and activity.

How can researchers verify the correct folding and activity of purified recombinant LytS protein?

Verifying correct folding and activity of recombinant LytS requires multiple complementary approaches:

Structural Assessment:

  • Circular dichroism (CD) spectroscopy to evaluate secondary structure content

  • Thermal shift assays to determine protein stability and potential ligand binding

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm oligomeric state

Functional Validation:

  • Autophosphorylation assays using γ-³²P-ATP or Phos-tag SDS-PAGE

  • Phosphotransfer assays to cognate response regulator (LytR)

  • ATP hydrolysis assays to measure kinase activity

For membrane proteins like LytS, nanodiscs or proteoliposomes can be used to reconstitute the protein in a more native-like membrane environment for functional studies. When assessing protein activity, researchers should include positive controls with well-characterized histidine kinases and negative controls with catalytically inactive mutants (H→A substitution at the phosphorylation site). Similar approaches for activity verification have been used for other B. cereus proteins, where optimal conditions for lytic activity were determined through systematic testing of buffer conditions, pH, and temperature .

What methods are most effective for studying LytS interactions with its cognate response regulator?

To characterize interactions between LytS and its cognate response regulator (likely LytR), researchers should employ multiple complementary techniques:

In vitro Interaction Studies:

  • Surface plasmon resonance (SPR) to determine binding kinetics and affinity

  • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

  • Microscale thermophoresis (MST) for interaction studies in various buffer conditions

  • Bacterial two-hybrid assays for validation in a cellular context

Phosphotransfer Analysis:

  • In vitro phosphorylation assays using purified proteins and γ-³²P-ATP

  • Phosphotransfer kinetics assays to determine rates of phosphoryl group transfer

  • Phos-tag SDS-PAGE to visualize phosphorylated vs. non-phosphorylated species

Structural Studies:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

  • Cross-linking coupled with mass spectrometry to identify proximity relationships

  • Co-crystallization attempts for atomic-level interaction details

When designing these experiments, researchers should consider including conditions that might influence the interaction, such as various divalent cations (Mg²⁺, Ca²⁺, Mn²⁺), pH values, and ionic strengths. Similar protein interaction mapping approaches have been used to characterize binding properties of B. cereus proteins, as seen in studies where fluorescently tagged domains were used to visualize binding to bacterial cell surfaces .

How can researchers identify environmental signals sensed by the LytS protein?

Identifying environmental signals sensed by LytS requires systematic screening approaches and validation studies:

Ligand Screening Methods:

  • Thermal shift assays with candidate ligands to detect stabilizing interactions

  • Differential scanning fluorimetry with compound libraries

  • Isothermal titration calorimetry (ITC) for direct binding measurements

  • Activity assays measuring autophosphorylation in response to potential signals

Candidate Signal Categories to Test:

  • Cell wall components: peptidoglycan fragments, lipoteichoic acids

  • Antibiotics: cell wall targeting compounds (β-lactams, glycopeptides)

  • Environmental stressors: pH changes, osmotic stress, membrane perturbations

  • Metabolites: intermediates from central carbon metabolism

Validation of Physiological Relevance:

  • Gene expression analysis comparing wild-type and lytS deletion strains under signal exposure

  • Phosphorylation state analysis in vivo under various conditions

  • Bacterial growth and morphology assessment in the presence of putative signals

When designing these experiments, researchers should consider that sensor histidine kinases often respond to multiple signals with varying affinities. Using recombinant protein constructs containing only the sensing domain may facilitate more direct binding studies. Similar systematic approaches have been utilized to characterize optimal conditions for protein activity in B. cereus studies, where variables like pH, temperature, and ionic conditions were methodically evaluated .

What are the most reliable methods for generating and validating lytS knockout or knockdown strains in B. cereus?

Creating and validating genetic modifications in B. cereus requires specialized approaches due to the challenges of working with this organism:

Gene Knockout Methods:

  • Homologous recombination using suicide vectors (pMAD or pBKJ236)

  • CRISPR-Cas9 systems adapted for B. cereus

  • Transposon mutagenesis with subsequent selection and screening

Genetic Knockdown Approaches:

  • Antisense RNA expression

  • CRISPR interference (CRISPRi) using catalytically inactive Cas9

  • Inducible promoter replacement for controlled expression

Validation Strategies:

  • PCR verification of genetic modifications

  • RT-qPCR to confirm altered transcript levels

  • Western blotting using antibodies against LytS (or epitope tags)

  • Whole genome sequencing to confirm specific modifications and rule out off-target effects

Complementation Controls:

  • Plasmid-based expression of wild-type lytS

  • Chromosomal restoration of lytS at native or ectopic loci

  • Expression of point mutants (e.g., H-box mutations) to dissect specific protein functions

When generating these strains, researchers should implement appropriate biosafety measures due to the pathogenic potential of B. cereus. Additionally, phenotypic characterization should include growth curves, microscopic examination of cell morphology, antibiotic susceptibility testing, and specific assays for autolysis and biofilm formation. Similar genetic approaches have been used in studies of B. cereus proteins, where recombinant strains were developed to facilitate visualization and characterization of protein-cell interactions .

How can researchers develop B. cereus LytS-based biosensors for detecting specific environmental signals?

Developing biosensors based on the B. cereus LytS protein leverages its natural signal sensing capabilities:

Design Strategies:

  • Whole-cell biosensors: Engineer B. cereus to produce reporter proteins (GFP, luciferase) under control of LytS/LytR-regulated promoters

  • Protein-based biosensors: Create chimeric proteins fusing LytS sensing domains with fluorescent proteins capable of FRET

  • Cell-free biosensors: Develop in vitro transcription-translation systems incorporating purified LytS/LytR and reporter constructs

Optimization Parameters:

  • Signal response range: Modulate expression levels of LytS and LytR components

  • Sensitivity: Introduce mutations in sensing domains based on structure-function knowledge

  • Specificity: Engineer binding pockets through directed evolution approaches

  • Response time: Adjust genetic circuit architectures to control kinetics

Performance Evaluation:

  • Dose-response curves across physiologically relevant concentrations

  • Cross-reactivity testing with similar compounds

  • Stability assessments under various environmental conditions

  • Limit of detection determination using standardized protocols

This approach builds on principles demonstrated in recent research where bacteriophage-derived proteins were used to detect B. cereus with high specificity in lateral flow assays . In that study, researchers achieved detection limits of approximately 10⁵ CFU/mL within 15 minutes using protein-nanoparticle biointerfaces. Similar principles could be applied to LytS-based biosensors, potentially offering comparable or improved performance metrics for specific signal detection.

What advanced structural biology techniques are most suitable for elucidating the conformational changes in LytS during signal sensing?

Elucidating the conformational dynamics of LytS during signal sensing requires sophisticated structural biology approaches:

High-Resolution Structural Methods:

  • X-ray crystallography of individual domains and full-length protein

    • Challenge: Capturing different conformational states

    • Strategy: Use of conformation-selective nanobodies or ligand complexes

  • Cryo-electron microscopy (cryo-EM)

    • Advantage: Can capture conformational ensembles

    • Application: Particularly valuable for full-length LytS in membrane environments

  • Nuclear magnetic resonance (NMR) spectroscopy

    • Strength: Provides dynamic information in solution

    • Approach: Methyl-TROSY for large proteins; domain-specific studies

Dynamic Conformational Analysis:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Data collection: Compare exchange patterns ± putative signals

    • Analysis: Identify regions with altered solvent accessibility

  • Single-molecule FRET (smFRET)

    • Design: Strategic placement of fluorophore pairs to monitor distance changes

    • Measurement: Real-time conformational changes upon signal addition

  • Molecular dynamics (MD) simulations

    • Scale: From focused active site simulations to whole-protein models

    • Integration: Combine with experimental restraints from HDX-MS or FRET

Methodological Considerations:

  • For membrane proteins like LytS, consider lipid nanodiscs or styrene-maleic acid copolymer (SMA) extraction to maintain native-like environment

  • Implement time-resolved approaches to capture transient conformational states

  • Combine multiple methods to build comprehensive conformational landscapes

Similar multi-technique structural approaches have proven valuable in characterizing other bacterial proteins, as evidenced by studies where microscopy techniques were combined with molecular analyses to understand binding properties and structural characteristics .

How does the LytS/LytR two-component system in B. cereus compare to homologous systems in other pathogenic bacteria, and what are the implications for cross-species antimicrobial strategies?

Comparative analysis of the LytS/LytR system across pathogenic bacteria reveals important evolutionary and functional insights with therapeutic implications:

Comparative Genomic Analysis:

SpeciesLytS Identity to B. cereus (%)LytR Identity to B. cereus (%)Key Functional Differences
B. anthracis85-95%88-96%Highly conserved; likely similar function
B. thuringiensis83-92%85-94%Conservation in regulatory regions
S. aureus40-45%38-42%Different sensory specificity
L. monocytogenes35-40%33-38%Altered regulon composition
C. difficile<30%<30%Significantly divergent function

Functional Conservation Assessment:

  • Regulon comparison across species using transcriptomics and ChIP-seq

  • Cross-complementation experiments to test functional interchangeability

  • Binding site motif analysis to identify conserved recognition sequences

  • Sensor domain comparison to identify conserved vs. species-specific signal recognition

Antimicrobial Strategy Implications:

  • Broad-spectrum potential: Target highly conserved regions involved in phosphotransfer

  • Narrow-spectrum approaches: Focus on species-specific sensor domain features

  • Anti-virulence strategies: Target LytS/LytR only in species where it regulates virulence

  • Resistance considerations: Evaluate potential for cross-resistance development

When designing these comparative studies, researchers should consider that even highly homologous proteins may have species-specific functions. The variability in binding specificity observed among closely related B. cereus proteins suggests that similar variability might exist in LytS/LytR systems across bacterial species. This variability could be exploited for species-selective antimicrobial approaches that minimize disruption of commensal bacteria.

What methodologies are most effective for identifying and validating the complete LytS/LytR regulon in B. cereus?

Comprehensive identification and validation of the LytS/LytR regulon requires integration of multiple genomic, transcriptomic, and functional approaches:

Global Regulon Mapping:

  • RNA-Seq comparing wild-type, ΔlytS, ΔlytR, and complemented strains

    • Conditions: Normal growth, stress conditions that activate the system

    • Analysis: Differential expression analysis with appropriate statistical thresholds

  • ChIP-Seq using epitope-tagged LytR

    • Design: Genomic integration of tagged LytR at native locus

    • Controls: Input DNA, non-specific antibody pulldowns

  • DNase-Seq or ATAC-Seq to identify changes in chromatin accessibility

    • Comparison: Wild-type vs. regulator deletion strains

    • Integration: Correlate with RNA-Seq and ChIP-Seq datasets

Binding Motif Characterization:

  • Motif discovery from ChIP-Seq peak regions

  • In vitro validation using electrophoretic mobility shift assays (EMSA)

  • Binding affinity determination via fluorescence polarization assays

  • Validation of motifs using reporter constructs with wild-type and mutated binding sites

Direct vs. Indirect Regulation Discrimination:

  • Time-course experiments with inducible LytR expression

  • Protein synthesis inhibition experiments (e.g., with chloramphenicol)

  • In vitro transcription assays with purified components

Functional Categorization:

  • Gene ontology enrichment analysis of the regulon

  • Pathway analysis to identify cellular processes under control

  • Integration with existing B. cereus regulatory network data

These approaches build on methodologies demonstrated in B. cereus research, where systematic testing of multiple bacterial strains revealed both conserved and variable functional properties . The presence of strain-specific binding patterns observed in these studies suggests that researchers should examine multiple B. cereus strains to establish core vs. variable components of the LytS/LytR regulon.

How can targeting the LytS/LytR system contribute to novel antimicrobial strategies against B. cereus infections?

The LytS/LytR two-component system represents a promising antimicrobial target due to its role in cell wall homeostasis and potentially virulence regulation:

Antimicrobial Strategy Development:

  • Direct inhibition approaches:

    • Small molecule inhibitors targeting LytS ATP-binding domain

    • Peptide inhibitors disrupting LytS-LytR interaction

    • CRISPR/Cas delivery systems targeting lytS/lytR genes

  • Potentiation strategies:

    • Compounds that overstimulate LytS, leading to dysregulated cell wall metabolism

    • Agents that block signal sensing, creating cellular stress response defects

    • Combination with conventional antibiotics targeting cell wall synthesis

Screening Methodologies:

  • High-throughput biochemical assays measuring LytS autophosphorylation

  • Whole-cell reporter assays monitoring LytS/LytR pathway activity

  • Bacterial growth inhibition assays with compound libraries

  • Structure-based virtual screening targeting key functional domains

Efficacy Evaluation Metrics:

ParameterMethodsConsiderations
Antimicrobial activityMIC/MBC determinationTest against diverse B. cereus strains
SpecificityActivity against related vs. distant bacteriaAssess therapeutic window
Resistance developmentSerial passage studiesDetermine frequency of resistance
Mode of actionTranscriptomics, metabolomicsConfirm target engagement
In vivo efficacyAnimal infection modelsPK/PD relationships

This approach builds on research showing that targeting bacterial regulatory systems can be effective, as demonstrated by the successful development of phage protein-based detection systems for B. cereus . The specific binding capabilities observed in these systems suggest that similar specificity could be achieved when targeting the LytS/LytR system for antimicrobial development.

What are the key methodological considerations for investigating the role of LytS in B. cereus biofilm formation and persistence?

Investigating LytS's role in biofilm formation requires specialized methodologies to capture the complexity of this developmental process:

Biofilm Formation Analysis:

  • Static biofilm assays:

    • Crystal violet staining for biomass quantification

    • Metabolic activity assays (XTT, resazurin) for viability assessment

    • Fluorescent reporter strains for spatial organization visualization

  • Flow-based systems:

    • Microfluidic devices for real-time monitoring

    • Flow cells coupled with confocal microscopy

    • Bioreactors for large-scale biofilm cultivation

  • Advanced imaging techniques:

    • Confocal laser scanning microscopy with live/dead staining

    • Super-resolution microscopy for subcellular localization of LytS

    • Scanning electron microscopy for detailed biofilm architecture

Gene Expression Studies:

  • Spatial transcriptomics to map expression patterns across biofilm regions

  • Single-cell RNA-Seq to capture heterogeneity within biofilm populations

  • Time-course analysis throughout biofilm development stages

  • Reporter constructs to monitor lytS expression in different microenvironments

Persistence and Stress Response:

  • Antimicrobial tolerance assays comparing planktonic and biofilm states

  • Nutrient limitation response in wild-type vs. ΔlytS strains

  • Persister cell formation quantification

  • Dispersal induction measurements under varying environmental conditions

Experimental Design Considerations:

  • Include both laboratory and clinical B. cereus isolates

  • Establish standardized growth conditions while examining environmental variable effects

  • Use complementation studies to confirm phenotype specificity

  • Implement relevant in vivo biofilm models when advancing to translational studies

These methodological approaches are informed by research demonstrating that B. cereus proteins show strain-specific binding patterns and activity profiles , suggesting that biofilm formation characteristics may similarly vary across strains and should be systematically investigated.

What bioinformatic pipelines are recommended for identifying and analyzing LytS homologs across the Bacillus cereus group and other bacterial species?

Comprehensive identification and analysis of LytS homologs requires robust bioinformatic workflows:

Homolog Identification Pipeline:

  • Initial sequence retrieval:

    • Use B. cereus LytS as query in BLASTP/PSI-BLAST against non-redundant databases

    • Employ position-specific scoring matrices (PSSMs) to capture remote homologs

    • Include profile hidden Markov models (HMMs) from Pfam/TIGR databases

  • Homology validation:

    • Domain architecture analysis using InterProScan

    • Reciprocal best-hit confirmation

    • Conservation of key functional residues (H-box, N-box, G-boxes)

  • Phylogenetic analysis:

    • Multiple sequence alignment using MAFFT or T-Coffee

    • Maximum likelihood tree construction with IQ-TREE or RAxML

    • Bayesian inference using MrBayes for alternative phylogenetic hypothesis testing

Genomic Context Analysis:

  • Automated operon prediction across genomes

  • Synteny visualization using tools like Geneious or SyntTax

  • Association with mobile genetic elements (prophages, transposons)

Functional Divergence Assessment:

  • Evolutionary rate analysis using PAML or HyPhy

  • Site-specific selection pressure calculation (dN/dS)

  • Co-evolutionary analysis with presumed partner proteins (LytR)

  • Structural modeling to map evolutionary conservation to protein structure

This approach is supported by research on B. cereus proteins that revealed variable conservation across strains and species . For instance, the LysBC17 gene was found to be present in only a subset of B. cereus strains, with a BlastN search against 147 completed B. cereus genomes showing variable conservation . Similar variability analysis for lytS would help identify core vs. accessory instances of this regulatory system across the Bacillus cereus group.

How can researchers effectively design experiments to investigate the evolutionary adaptation of the LytS/LytR system across different ecological niches occupied by B. cereus group bacteria?

Investigating the evolutionary adaptation of the LytS/LytR system requires integration of ecological, genomic, and experimental approaches:

Ecological Niche Sampling Strategy:

  • Systematic collection from diverse environments:

    • Soil samples across different ecosystems

    • Food production environments

    • Clinical isolates from various infection types

    • Insect-associated isolates (particularly for B. thuringiensis comparison)

  • Isolation and characterization:

    • Selective media for B. cereus group bacteria

    • Whole genome sequencing of isolates

    • Phylogenomic classification

    • Ecological metadata collection

Comparative Genomic Analysis:

  • LytS/LytR sequence variation analysis:

    • Allele identification and frequency distribution

    • Correlation with ecological source

    • Identification of niche-specific sequence signatures

  • Selection pressure analysis:

    • dN/dS calculations across ecological groups

    • Tests for diversifying vs. purifying selection

    • Identification of positively selected codons

  • Associated genomic features:

    • Co-occurring regulatory elements

    • Regulon composition variations

    • Mobile genetic element associations

Functional Validation Experiments:

  • Cross-complementation assays:

    • Exchange lytS/lytR alleles between strains from different niches

    • Measure fitness effects under various conditions

  • Directed evolution experiments:

    • Serial passage under niche-mimicking conditions

    • Monitor lytS/lytR sequence changes

    • Correlate with adaptive phenotypes

  • Protein engineering and domain swapping:

    • Create chimeric LytS proteins with sensor domains from different niches

    • Test signal response specificity

This approach builds on methodologies seen in research where protein binding specificities were systematically tested across multiple B. cereus strains . These studies revealed that even closely related strains can show different binding patterns and activities, suggesting ecological adaptations of protein function that could extend to the LytS/LytR system.

What statistical approaches are most appropriate for analyzing complex datasets from LytS functional studies across multiple B. cereus strains?

Analyzing complex multi-strain datasets from LytS studies requires robust statistical frameworks:

Experimental Design Considerations:

  • Power analysis to determine sample sizes for strain comparisons

  • Balanced design with appropriate technical and biological replicates

  • Inclusion of relevant controls for each strain background

  • Randomization and blinding where applicable

Statistical Analysis Pipeline:

  • Data preprocessing:

    • Outlier detection and handling (Grubbs' test, Dixon's Q test)

    • Normality testing (Shapiro-Wilk, Kolmogorov-Smirnov)

    • Transformation selection if needed (log, Box-Cox)

  • Comparative analysis frameworks:

    • ANOVA with post-hoc tests for multi-strain comparisons

    • Linear mixed effects models to account for batch effects

    • Non-parametric alternatives (Kruskal-Wallis, Mann-Whitney U)

  • Advanced statistical approaches:

    • Multivariate analysis (PCA, NMDS) for complex phenotypic data

    • Hierarchical clustering to identify strain groupings

    • Machine learning algorithms for pattern recognition

Multiple Testing Correction:

Correction MethodUse CaseStrengths/Limitations
BonferroniConservative control of family-wise error rateMay be too stringent for large datasets
Benjamini-HochbergControls false discovery rateBetter power than Bonferroni
SidakLess conservative than BonferroniAssumes independence between tests
Permutation-basedNon-parametric approachComputationally intensive but robust

Visualization Strategies:

  • Forest plots for effect size comparison across strains

  • Heat maps for multivariate data visualization

  • Interactive dashboards for complex dataset exploration

This statistical framework is supported by research on B. cereus proteins that required robust statistical analysis to compare binding and activity across multiple strains . For example, statistical analysis was necessary to determine significant differences between B. cereus strains in lateral flow assay tests, where p-values were calculated to establish detection reliability .

How can researchers reconcile contradictory findings when characterizing LytS function across different experimental systems and B. cereus strains?

Reconciling contradictory findings requires systematic investigation of potential sources of variation:

Source of Variation Assessment:

  • Strain-specific factors:

    • Genetic background differences (SNPs, indels)

    • Regulatory network variations

    • Growth phase-dependent expression patterns

  • Methodological considerations:

    • Differences in experimental conditions (media, temperature, pH)

    • Variations in protein expression and purification protocols

    • Detection system sensitivities and dynamic ranges

  • Data analysis approaches:

    • Different statistical methods applied

    • Threshold selection variations

    • Normalization procedures

Reconciliation Strategy:

  • Direct comparative experiments:

    • Side-by-side testing of strains under identical conditions

    • Standardized protocols across laboratories

    • Round-robin testing between research groups

  • Genetic dissection:

    • Creation of isogenic strains differing only in lytS alleles

    • Targeted mutagenesis to identify causative variants

    • Whole genome sequencing to identify compensatory mutations

  • Meta-analysis approaches:

    • Systematic review of methodologies

    • Statistical integration of results across studies

    • Identification of moderator variables explaining discrepancies

Case Resolution Framework:

  • Establish a minimal standardized experimental protocol

  • Create a decision tree for discrepancy resolution

  • Implement data sharing and collaborative validation

  • Develop strain- and condition-specific predictive models

This approach is supported by research on B. cereus proteins where binding variability was observed even among closely related strains . For example, the GFP-CWB fusion protein showed differential binding to various B. cereus strains despite their genetic similarity, with some strains (like B. cereus ATCC 13061) showing poor binding despite being efficiently lysed by the same protein . Similar strain-specific variations might explain contradictory findings in LytS studies.

What emerging technologies are most promising for advancing our understanding of LytS function in B. cereus pathogenesis?

Several cutting-edge technologies hold significant promise for elucidating LytS function in pathogenesis:

Single-Cell Technologies:

  • Single-cell RNA-Seq to reveal population heterogeneity in lytS expression

  • CyTOF (mass cytometry) with metal-labeled antibodies for protein-level analysis

  • Microfluidic single-cell isolation for clonal analysis of phenotypic variants

Advanced Imaging Platforms:

  • Super-resolution microscopy (STORM, PALM) for subcellular LytS localization

  • Light-sheet microscopy for 3D visualization in tissue infection models

  • Correlative light and electron microscopy (CLEM) linking localization to ultrastructure

  • Cryo-electron tomography for molecular-resolution imaging in near-native state

Genome Engineering Tools:

  • CRISPR interference (CRISPRi) for tunable gene repression

  • Base editing for precise point mutations without double-strand breaks

  • Optogenetic control of LytS activity for spatiotemporal manipulation

  • Biosensors for real-time activity monitoring in vivo

Host-Pathogen Interaction Models:

  • Organ-on-chip systems mimicking host tissues

  • 3D organoid infection models

  • Humanized mouse models for enhanced clinical relevance

  • Live cell-pathogen imaging platforms with fluorescent reporters

Systems Biology Approaches:

  • Multi-omics integration (transcriptomics, proteomics, metabolomics)

  • Network modeling of regulatory circuits

  • Machine learning for pattern recognition in complex datasets

  • Digital twin modeling for prediction of infection outcomes

These emerging technologies build upon methodological advances demonstrated in recent B. cereus research, where innovative approaches like AuNP-based lateral flow assays with phage-derived proteins have enabled rapid detection with high specificity . Similar technological innovations could dramatically advance our understanding of LytS function in pathogenesis.

What are the critical unresolved questions regarding the LytS/LytR system that require collaborative, multi-laboratory research initiatives?

Advancing understanding of the LytS/LytR system requires coordinated research efforts addressing these unresolved questions:

Fundamental Mechanistic Questions:

  • What is the complete spectrum of signals sensed by LytS across different ecological niches?

  • How does signal binding trigger conformational changes leading to autophosphorylation?

  • What determines the specificity of LytS-LytR phosphotransfer?

  • How does the LytS/LytR system interact with other regulatory networks?

Pathogenesis-Related Questions:

  • What is the contribution of LytS/LytR to virulence in different infection models?

  • How does the system influence host immune response evasion?

  • What is the role of LytS/LytR in biofilm-associated infections?

  • How does environmental sensing via LytS affect adaptation during infection?

Evolutionary Considerations:

  • What drives the selection pressure on lytS/lytR across Bacillus species?

  • How has horizontal gene transfer shaped the evolution of this regulatory system?

  • What explains the variable conservation of regulatory targets across strains?

  • How do niche adaptations manifest in sequence and functional variations?

Collaborative Research Framework Requirements:

Research ComponentRequired ResourcesCollaborative Structure
Strain repositoryCollection of diverse clinical and environmental isolatesCentralized biobank with standardized metadata
Genetic toolkitStandard constructs for manipulation across strainsShared plasmid repository with validation protocols
Data standardizationCommon formats and minimal reporting standardsDedicated database with controlled vocabulary
Methodology harmonizationAgreed-upon core protocolsInter-laboratory validation studies
Computational infrastructureShared analysis pipelinesCloud-based collaborative platform

These collaborative initiatives would build upon approaches seen in B. cereus research where systematic testing across multiple strains revealed important functional variations . Multi-laboratory initiatives would enable the comprehensive characterization needed to resolve these complex questions about the LytS/LytR system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.