Recombinant Bacillus cereus Stage II sporulation protein SA (spoIISA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
spoIISA; BC_2436; Stage II sporulation protein SA; Killer protein SpoIISA; Toxin SpoIISA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)
Target Names
spoIISA
Target Protein Sequence
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDL TLWKNLLMFTAMVIFVDIAFILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTT IIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKIVVFEAAKELNTNFRGIRSQF SIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH SYFSK
Uniprot No.

Target Background

Function

This protein is a toxic component of a type II toxin-antitoxin (TA) system. Its expression in E. coli inhibits growth. However, co-expression with SpoIISB in E. coli restores normal growth.

Database Links

KEGG: bce:BC2436

STRING: 226900.BC2436

Protein Families
SpoIISA toxin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the composition of the SpoIIS system in Bacillus cereus?

The SpoIIS system in Bacillus cereus is a three-component system, consisting of the membrane-bound SpoIISA toxin and two antitoxins: SpoIISB and SpoIISC. Unlike the originally identified SpoIIS system in B. subtilis which was thought to have only two components, the B. cereus system includes the additional SpoIISC protein that can also bind to SpoIISA and neutralize its toxic effect . The spoIIS operon in B. cereus contains three genes: spoIISA, spoIISB, and spoIISC, all of which contribute to the functional toxin-antitoxin system .

How does the SpoIISA toxin function in bacterial cells?

SpoIISA functions as a membrane-bound toxin that, when expressed at higher levels without its cognate antitoxins, leads to the formation of plasmolysis zones in the cytoplasmic membrane, ultimately causing cell death . The toxic effect has been demonstrated in both native Bacillus species and heterologous systems like E. coli . Research indicates that SpoIISA's toxicity may be related to its ability to form higher oligomers, which could be essential for its toxic function . The cytoplasmic domain of SpoIISA (C-SpoIISA) can interact with itself, suggesting that oligomerization plays a role in the protein's mechanism of action .

What techniques are most effective for studying SpoIISA protein interactions?

The bacterial two-hybrid system has proven particularly effective for studying SpoIISA protein interactions in vivo. This approach involves:

  • Fusion of T25 and T18 fragments from adenylate cyclase with C-terminal domain of SpoIISA and full-length SpoIISB and SpoIISC proteins

  • Co-transformation of E. coli BTH101 with relevant plasmid combinations

  • Plating on LB media supplemented with ampicillin, kanamycin, X-Gal, and IPTG

  • Incubation for 48 hours at room temperature to observe interactions

For in vitro confirmation of protein interactions identified through the two-hybrid system, pull-down assays have been successfully employed . These complementary approaches provide robust validation of protein-protein interactions within the SpoIIS system.

How can recombinant SpoIISA be expressed and purified for functional studies?

Expression and purification of recombinant SpoIISA can be achieved through the following protocol:

  • Construct expression vectors containing SpoIISA with appropriate tags (e.g., His6 tag)

  • Transform into an E. coli expression strain

  • Induce protein expression using IPTG or similar inducers

  • Extract and purify the protein using affinity chromatography

Specific vectors such as pET15b-Bc-HCIISA (containing His6-tagged C-terminal domain of B. cereus SpoIISA) have been successfully used for expression studies . For co-expression studies with antitoxins, dual-expression vectors like pETDuet-Bc-HCIISAC have proven effective, allowing simultaneous expression of the toxin and antitoxin components .

What is the methodology for assessing SpoIISA toxicity in bacterial systems?

The kill/rescue assay provides a robust methodology for evaluating SpoIISA toxicity:

  • Resuspend a single colony of transformed E. coli MM294 in 100 μl LB

  • Grow overnight on LB agar plates

  • Wash off the bacterial lawn with 1 ml LB

  • Use this primary culture to inoculate a second generation in LB with 100 μg ml−1 ampicillin and 0.5% glucose

  • Set starting OD600 to 0.05-0.06

  • Cultivate at 37°C with shaking at 150 rpm

  • Monitor growth by measuring OD600 at 1-hour intervals

  • When OD600 reaches 0.4, induce spoIIS expression by adding L-arabinose to 0.02% (w/v)

This protocol allows for precise temporal control of SpoIISA expression and quantitative assessment of its impact on bacterial growth and viability.

How can CRISPR/Cas9 be utilized for studying SpoIISA function in B. cereus?

CRISPR/Cas9 technology offers a powerful approach for genetic manipulation of SpoIISA in B. cereus, with the following key considerations:

  • Design appropriate guide RNAs targeting the spoIISA gene

  • Construct homology-directed repair templates for precise modifications

  • Introduce the CRISPR/Cas9 components into B. cereus cells

  • Screen for successful genome edits

This approach is particularly valuable as the B. cereus group, including B. anthracis and B. cereus, has very low homologous recombination efficiencies, making traditional gene modification methods challenging . Recent developments have demonstrated successful CRISPR/Cas9-mediated genome editing in B. anthracis and B. cereus with high efficiency, achieving up to 100% modification rates for smaller genomic fragments .

What strategies can overcome the challenges in genetic manipulation of Bacillus species?

The genetic manipulation of Bacillus species presents significant challenges due to their low homologous recombination efficiency. The following strategies can help overcome these limitations:

  • CRISPR/Cas9-based editing: Recent development of CRISPR/Cas9 systems for B. anthracis and B. cereus has demonstrated highly efficient genome modifications without the need for antibiotic selection markers

  • Optimization of transformation protocols: Enhancing transformation efficiency through optimized electroporation conditions or protoplast transformation methods

  • Temperature-sensitive plasmids: Using temperature-sensitive vectors for improved plasmid curing after genome editing

  • Integration of multiple selection markers: Employing counterselection systems to increase the likelihood of identifying true recombinants

For point mutations in genes like spoIISA, CRISPR/Cas9 has proven particularly effective, with successful examples in related genes such as plcR in B. cereus .

What plasmid systems are optimal for expression studies of SpoIISA and its interaction partners?

Based on successful experimental approaches, the following plasmid systems are recommended for SpoIISA studies:

Plasmid TypeApplicationExamplesFeatures
Expression VectorsProtein productionpET15b-Bc-HCIISAT7lac promoter, His6 tag
Co-expression VectorsToxin-antitoxin interactionpETDuet-Bc-HCIISACDual T7lac promoters
Bacterial Two-HybridProtein interaction testingpUTCIISA/pKTCIISAT18/T25 adenylate cyclase fragments
CRISPR/Cas9Genome editingCRISPR plasmids for BacillusGuide RNA expression, Cas9

These plasmid systems allow for versatile experimental approaches to study SpoIISA function and interactions . For two-hybrid studies, combinations like pUTCIISC Bc (T18 fusion) with pKTIISC Bc (T25 fusion) have been successfully employed to detect interactions between SpoIISA and its binding partners .

What role does SpoIISA oligomerization play in its toxicity mechanism?

SpoIISA oligomerization appears to be a critical aspect of its toxicity mechanism:

  • B. cereus SpoIISA can form higher oligomers beyond the dimer structure

  • The C-terminal domain of SpoIISA (C-SpoIISA) can interact with other C-SpoIISA molecules as demonstrated through bacterial two-hybrid systems

  • This oligomerization may be essential for forming functional complexes in the bacterial membrane

  • The toxicity may relate to the formation of pores or disruption of membrane integrity through oligomeric structures

Understanding the relationship between oligomerization and toxicity provides insights into potential mechanisms of SpoIISA function and may inform strategies for manipulating this system in experimental contexts .

How do the SpoIISB and SpoIISC antitoxins neutralize SpoIISA toxicity?

Both SpoIISB and SpoIISC function as antitoxins that can neutralize SpoIISA toxicity through direct protein-protein interactions:

  • SpoIISB binds to the cytoplasmic domain of SpoIISA, forming a heterotetrameric complex with C-SpoIISA2:SpoIISB2 stoichiometry

  • SpoIISC similarly binds to SpoIISA and abolishes its toxic effect

  • These interactions likely prevent SpoIISA oligomerization or otherwise interfere with its toxic mechanism

  • Both antitoxins can neutralize SpoIISA toxicity when co-expressed in E. coli systems

The presence of two distinct antitoxins in B. cereus suggests potential functional redundancy or specialized roles in different physiological conditions or developmental stages .

What is the relationship between SpoIISA function and bacterial sporulation?

The relationship between SpoIISA and bacterial sporulation presents a complex picture:

These findings suggest that SpoIISA may function as a checkpoint in the sporulation process, with SpoIISB required to neutralize its potentially detrimental effects during normal sporulation .

How can expression toxicity be managed when working with recombinant SpoIISA?

Managing SpoIISA toxicity during recombinant expression requires careful consideration of several factors:

  • Tight expression control: Use stringent promoter systems like T7lac with glucose repression to prevent leaky expression

  • Co-expression with antitoxins: Simultaneous expression of SpoIISB or SpoIISC can neutralize toxicity

  • Induction optimization: Carefully titrate inducer concentrations and induction timing to balance protein production against toxicity

  • Expression of non-toxic domains: Work with the C-terminal domain (C-SpoIISA) rather than full-length protein when possible

  • Host strain selection: Choose E. coli strains optimized for toxic protein expression

These strategies have been successfully employed in experimental studies of SpoIISA and can significantly improve recombinant protein yields while minimizing toxic effects on the expression host .

What are common pitfalls in bacterial two-hybrid systems for studying SpoIIS proteins?

When employing bacterial two-hybrid systems to study SpoIIS protein interactions, researchers should be aware of these common pitfalls:

  • False negatives: Protein fusion orientation can significantly impact detection of interactions; testing both N- and C-terminal fusions is recommended (e.g., pUTCIISC and pKNTIISC vs. pKTIISC)

  • Expression levels: Imbalanced expression of fusion proteins may lead to misleading results

  • Protein folding issues: Tag interference with proper protein folding can prevent detection of legitimate interactions

  • Membrane protein challenges: The membrane-bound nature of full-length SpoIISA can complicate two-hybrid analysis

  • Autoactivation: Some constructs may cause reporter activation independent of protein-protein interactions

To address these challenges, comprehensive controls and multiple construct orientations should be tested, as exemplified by the approach using various combinations like pUTCIISC Bc, pKTIISC Bc, and pKNTIISC Bc in published protocols .

How might CRISPR/Cas9 genome editing advance SpoIISA research?

CRISPR/Cas9 genome editing offers several promising avenues for advancing SpoIISA research:

  • Precise point mutations: Generation of specific amino acid substitutions to identify critical residues for toxicity or antitoxin binding

  • Domain swapping: Creation of chimeric proteins between B. cereus and B. subtilis SpoIISA to identify species-specific functional elements

  • Regulatory element manipulation: Modification of promoter regions to understand expression regulation

  • Marker-free mutations: Generation of clean deletions or modifications without antibiotic resistance markers

  • Large fragment deletions: Removal of entire spoIIS operons to study system-level effects

The demonstrated efficiency of CRISPR/Cas9 in B. anthracis and B. cereus (up to 100% for smaller modifications) makes this an attractive approach for future SpoIISA studies .

What potential applications exist for engineered SpoIISA systems in biotechnology?

Engineered SpoIISA systems hold potential for various biotechnological applications:

  • Inducible cell lysis systems: Controlled expression of SpoIISA without antitoxins could create programmable lysis mechanisms

  • Containment systems: Integration of SpoIISA as a genetic safeguard in engineered bacteria

  • Protein expression control: Using the toxin-antitoxin balance to regulate heterologous protein production

  • Selective antimicrobials: Development of compounds that interfere with SpoIISA-antitoxin interactions

  • Research tools: Creation of conditional knockout systems in Bacillus species

The ability to precisely manipulate these systems using modern genome editing techniques like CRISPR/Cas9 enhances their potential utility in these applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.