Recombinant Bacillus cereus subsp. cytotoxis Antiholin-like protein LrgB (lrgB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

LrgB operates within the LrgAB holin-antiholin system, which regulates peptidoglycan hydrolase activity and cell autolysis:

  • Holin-Antiholin Dynamics:

    • LrgB acts as an antiholin-like protein, counteracting the pore-forming activity of holins (e.g., LrgA) to prevent premature cell lysis .

    • Overexpression of lrgAB induces cell death by disrupting membrane potential, even in sporulating cells .

  • Genetic Regulation:

    • Expression of lrgB is repressed by CdsR, an ArsR family transcriptional regulator. Deletion of cdsR leads to uncontrolled lrgAB expression and cell lysis .

    • lrgB works synergistically with endolysins (e.g., CwlD) to degrade peptidoglycan, facilitating cell wall breakdown .

Key Research Findings

Recent studies highlight the protein’s mechanistic and applied relevance:

3.1. Mechanism of Action

  • Stepwise Pore Formation: LrgB binds to the bacterial membrane first, followed by recruitment of other toxin components (e.g., LrgA), leading to pore assembly and cell death .

  • Cross-Toxin Compatibility: LrgB is incompatible with structurally similar toxins like Nhe, indicating functional specificity in pore-forming systems .

3.2. Experimental Models

  • In Vitro Cytotoxicity: Recombinant LrgB causes rapid lysis of Chinese Hamster Ovary (CHO) cells and murine models when combined with holins .

  • Autolysis Rates: Strains overexpressing lrgAB exhibit 2–3× higher autolytic activity compared to wild-type B. cereus .

Applications and Relevance

  • Biotechnological Tool: Used to study bacterial programmed cell death and sporulation pathways .

  • Antimicrobial Research: Insights into LrgB’s role could inform strategies to disrupt biofilm formation or bacterial persistence .

Comparative Analysis of Recombinant Variants

FeatureB. cytotoxicus LrgB B. cereus B4264 LrgB
UniProt IDA7GVI2B7HGA1
Expression HostE. coliYeast
TagHis-tagUndisclosed
Sequence CoverageFull-length (1–230 aa)Partial

Challenges and Future Directions

  • Structural Resolution: The exact membrane interaction mechanism of LrgB remains uncharacterized .

  • Pathway Elucidation: Further studies are needed to map its regulatory networks in B. cereus pathogenesis .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please indicate your preference in the order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on your location and purchase method. For precise delivery estimates, please contact your local distributor.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form can be stored for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
lrgB; Bcer98_3956; Antiholin-like protein LrgB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Target Names
lrgB
Target Protein Sequence
MASTMTPYFGIVVSLIAYGIGTFLFKHSKQFFLFTPLFVAMVLGIGFLKVGNFTFEEYNT GGKIISFFLEPATIAFAIPLYKQADKLKKYWWQILSAIIVGSICSVVVVFIVAKAIHLDT AIMNSMLPQAATTAIALPLSESIGGIPAITSFAVIFNAVIVYALGALFLKTFRVKNPIAK GLALGTAGHALGVAVGIEMGEVEAAMASIAVTVVGVVTVVVIPLFMPLIA
Uniprot No.

Target Background

Function
LrgB inhibits the expression or activity of extracellular murein hydrolases by interacting, possibly with LrgA, with the holin-like protein CidA. The LrgAB and CidA proteins may affect the proton motive force of the membrane. LrgB may be involved in programmed cell death (PCD), potentially triggering PCD in response to antibiotics and environmental stresses.
Database Links
Protein Families
CidB/LrgB family, LrgB subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular function of LrgB in Bacillus cereus?

LrgB is a membrane protein analogous to phage anti-holin proteins belonging to a family of orthologs that prevent membrane depolarization or hole formation . Although initially annotated as an antiholin protein, recent research has demonstrated that the LrgAB complex can indeed function as a holin, inducing cell lysis in certain contexts . The protein contains multiple transmembrane domains and is co-expressed with LrgA from the lrgAB operon. Together, these proteins form a functional complex involved in regulating cell death pathways in Bacillus species.

Methodological approach for studying LrgB function:

  • Generate clean deletion mutants (Δlrg strains)

  • Create complementation strains to confirm phenotypes

  • Conduct comparative membrane permeability assays between wild-type and mutant strains

  • Perform fluorescence microscopy with membrane-potential sensitive dyes

How does LrgB regulate cell death in Bacillus species?

LrgB functions as part of the LrgAB complex which plays a critical role in regulating programmed cell death and autolysis. Studies have shown that overexpression of the lrgAB operon results in cellular autolysis without sporulation, a phenomenon not observed when lrgA and lrgB are overexpressed individually . This suggests that LrgAB functions as a complex to induce cell lysis under specific conditions. Quantitative analysis revealed that overexpression of lrgAB led to approximately 50.63(±9.31)% dead cells compared to 16.93(±4.63)% in wild-type strains at T17 .

The LrgAB complex appears to work in conjunction with endolysins such as CwlD to facilitate the degradation of peptidoglycan and subsequent cell lysis. This controlled autolysis is particularly important during developmental processes such as sporulation, where maternal cell death is necessary for spore release.

StrainPercentage of Dead Cells at T17
Wild-type HD7316.93(±4.63)%
O lrgAB strain50.63(±9.31)%

What is the relationship between LrgB and biofilm formation?

LrgB plays a significant role in biofilm formation across Bacillus species. Inactivation of lrgB significantly increases biofilm formation, while overexpression of lrgB inhibits biofilm accumulation . This relationship appears to be mediated through the regulation of extracellular DNA (eDNA) release. When lrgB is inactivated, increased autolysis leads to greater eDNA release, which serves as a structural component in biofilm matrices .

In B. cereus, biofilm formation ability of the ΔgapBΔlrgAB double mutant was partially recovered compared to the ΔgapB single mutant, but still lower than the ΔlrgAB mutant alone . This suggests a complex regulatory network wherein LrgB influences both cell lysis and subsequent biofilm development.

Methodological considerations for biofilm studies:

  • Use crystal violet staining for quantitative biofilm assessment

  • Apply fluorescence microscopy with live/dead staining to visualize cell viability within biofilms

  • Quantify extracellular DNA in biofilm matrices using fluorometric assays

  • Compare biofilm structure in static versus flow conditions

What regulatory elements control lrgB expression in Bacillus cereus?

The expression of lrgB in Bacillus species is regulated by several factors that integrate environmental signals with cellular physiology:

  • CdsR (Cell death and sporulation Regulator) - In B. thuringiensis, this novel ArsR family transcriptional regulator directly represses lrgAB expression . Deletion of cdsR causes significant upregulation of lrgAB transcription, resulting in cellular autolysis and inhibited sporulation.

  • GapB (Glyceraldehyde-3-phosphate dehydrogenase) - In B. cereus, GapB acts as an upstream regulator of LrgAB. Transcriptome analysis revealed that gapB deletion caused a 6.17-fold increase in lrgAB expression . This regulation appears to link metabolic status with cell death decisions.

  • Growth phase - Expression levels of lrgAB vary throughout growth phases, with particular relevance during transition to stationary phase when decisions between cell death and sporulation are made.

These regulatory mechanisms ensure appropriate timing and extent of lrgAB expression, preventing premature autolysis while facilitating necessary cell death events during development.

How does the LrgAB system interact with sporulation pathways?

The LrgAB system plays a critical role in the coordination between cell death and sporulation in Bacillus species. Research has identified CdsR as a pivotal regulator that inhibits cell lysis while promoting sporulation . When CdsR is absent, increased expression of lrgAB leads to cell lysis without sporulation, suggesting that proper regulation of the LrgAB system is essential for successful spore development.

During sporulation, bacterial cells must carefully orchestrate the timing of maternal cell lysis to ensure proper spore maturation and release. The LrgAB complex appears to be one mechanism by which this process is regulated. Overexpression of lrgAB triggers premature cell lysis, disrupting the sporulation process, while proper regulation allows for coordinated maternal cell death only after spore formation is complete.

Methodological approaches for studying LrgAB-sporulation interactions:

  • Phase-contrast microscopy to monitor sporulation progression

  • Sporulation efficiency assays comparing wild-type and lrgAB mutants

  • Time-course analysis of gene expression during sporulation

  • Fluorescent reporter constructs to visualize lrgAB expression patterns

What experimental approaches are most effective for studying recombinant LrgB function?

To effectively study recombinant LrgB function, researchers should consider these methodological approaches:

  • Expression systems:

    • E. coli-based systems for high yield but may lack proper folding

    • Bacillus-based systems for native-like post-translational modifications

    • Mammalian cell systems for studying interaction with host cells

  • Protein purification strategies:

    • Use mild detergents (DDM, LDAO) to maintain membrane protein structure

    • Consider protein fusion tags that can be cleaved post-purification

    • Verify protein folding using circular dichroism spectroscopy

  • Functional assays:

    • Liposome reconstitution to study membrane permeabilization

    • Membrane potential assays using voltage-sensitive dyes

    • Cell lysis assays comparing wild-type and recombinant protein activity

  • Interaction studies:

    • Pull-down assays to identify protein partners

    • Bacterial two-hybrid systems to study protein-protein interactions

    • Surface plasmon resonance to measure binding kinetics

When studying recombinant LrgB, researchers should be cautious about potential artifacts introduced during the recombinant production process, such as improper folding or altered membrane integration.

How might LrgB contribute to the pathogenicity of B. cereus strains?

LrgB may influence B. cereus pathogenicity through several mechanisms:

  • Biofilm regulation - LrgB's role in controlling biofilm formation affects bacterial persistence in host tissues. B. cereus strains with altered lrgB function show differences in biofilm production , which could impact their ability to colonize hosts and resist antimicrobials.

  • Extracellular DNA release - The LrgAB system regulates extracellular DNA release through controlled cell lysis . This eDNA contributes to biofilm structure and may facilitate horizontal gene transfer of virulence factors between bacteria.

  • Stress resistance - Research on B. cereus has identified genes like adhB (alcohol dehydrogenase) that contribute to pathogenicity by enhancing resistance to nitric oxide and oxidative stress . Similar stress response mechanisms might involve LrgB, as proper regulation of cell death pathways is crucial for surviving host immune defenses.

  • Toxin release - Controlled autolysis mediated by the LrgAB system could influence the release of intracellular toxins during infection, potentially affecting virulence.

Understanding LrgB's contribution to pathogenicity could inform new approaches to combat B. cereus infections, particularly those caused by emergent strains that exhibit anthrax-like disease .

What is the relationship between GapB and LrgB in cellular metabolism and biofilm formation?

GapB (glyceraldehyde-3-phosphate dehydrogenase) and LrgB form a unique regulatory axis that connects central carbon metabolism with cell death and biofilm formation in B. cereus. Transcriptome analysis revealed that gapB deletion caused a 6.17-fold increase in lrgAB expression, making it one of the most significantly upregulated genes in the ΔgapB mutant .

The regulatory relationship appears to function through these mechanisms:

  • GapB regulates biofilm formation independently of exopolysaccharides and typical SinI/R regulatory systems .

  • The effect seems to be mediated through the release of extracellular DNA, as counting of living and dead cells in biofilms showed that the number of living cells in the ΔgapB strain biofilm was approximately 7.5 times greater than in wild-type B. cereus .

  • Deletion of both lrgAB and gapB (ΔgapBΔlrgAB) partially restored biofilm formation compared to the ΔgapB single mutant, confirming that GapB functions upstream of LrgAB in this regulatory pathway .

This connection between central metabolism (through GapB) and cell death regulation (through LrgB) likely represents a mechanism by which bacteria can integrate their metabolic status with decisions about cell death and community behavior.

How should researchers optimize purification protocols for recombinant LrgB?

Purifying recombinant LrgB presents several challenges due to its membrane-associated nature. A systematic approach should include:

  • Extraction optimization:

    • Test various detergents (DDM, LDAO, OG) at different concentrations

    • Compare solubilization efficiency at different temperatures (4°C, room temperature)

    • Optimize solubilization time (2-24 hours)

  • Affinity chromatography strategies:

    • N-terminal vs. C-terminal tag placement (consider which end is likely cytoplasmic)

    • Tag options: His6, Strep-tag II, FLAG tag

    • Include protease inhibitors throughout purification

  • Protein stability considerations:

    • Buffer optimization (pH range 6.0-8.0, various salt concentrations)

    • Addition of glycerol (10-20%) to prevent aggregation

    • Consider lipid supplementation to maintain native-like environment

  • Quality control:

    • Size exclusion chromatography to assess oligomeric state

    • Circular dichroism to confirm secondary structure

    • Western blotting to verify identity and integrity

Researchers should monitor protein activity throughout purification using functional assays relevant to LrgB's role in membrane permeabilization.

What methods are most effective for studying LrgB-mediated cell death in laboratory settings?

To effectively study LrgB-mediated cell death, researchers should employ multiple complementary approaches:

  • Genetic manipulation strategies:

    • Generate clean deletion mutants (ΔlrgB)

    • Create complementation strains with controlled expression

    • Develop inducible overexpression systems for temporal control

  • Cell viability assessment:

    • SYTOX Green staining to quantify dead cells (as used in studies showing 50.63% dead cells in lrgAB overexpression strains compared to 16.93% in wild-type)

    • Flow cytometry for high-throughput analysis of cell populations

    • Time-lapse microscopy to observe lysis events in real-time

  • Autolysis quantification:

    • Turbidity reduction assays to measure cell lysis rates

    • Zymography to detect autolysin activity

    • Peptidoglycan hydrolase assays

  • Gene expression analysis:

    • RT-qPCR to measure lrgB expression levels under different conditions

    • RNA-Seq for genome-wide transcriptional responses

    • Reporter gene fusions to visualize expression patterns

These approaches, used in combination, provide comprehensive insights into how LrgB influences cell death processes in Bacillus species.

What are the potential applications of LrgB in biotechnology and medicine?

The unique properties of LrgB as a regulator of cell death and biofilm formation suggest several potential applications:

  • Biofilm control strategies:

    • Engineered LrgB variants could be developed to disrupt biofilms in industrial settings

    • Targeting LrgB function could enhance biofilm dispersal in medical device infections

    • Modulating LrgB expression might prevent biofilm formation during food processing

  • Antimicrobial development:

    • Small molecules targeting LrgB function could trigger premature cell lysis

    • Understanding LrgB's role in stress resistance could reveal new vulnerabilities

    • Combination therapies targeting both LrgB and conventional antimicrobial targets

  • Biotechnological tools:

    • Controlled cell lysis systems based on LrgAB could be developed for protein release

    • Engineered LrgB variants might improve recombinant protein production

    • LrgB-based biosensors could detect specific environmental conditions

  • Vaccine development:

    • Understanding LrgB's role in B. cereus pathogenicity could inform new vaccine strategies

    • LrgB epitopes might serve as targets for protective immunity

Research into these applications requires deeper understanding of LrgB structure-function relationships and regulatory mechanisms.

What structural studies would advance our understanding of LrgB function?

Elucidating the structure of LrgB would significantly advance our understanding of its function. Priority areas include:

  • Full-length structure determination:

    • X-ray crystallography of detergent-solubilized LrgB

    • Cryo-electron microscopy of the LrgAB complex in nanodiscs

    • NMR studies of specific domains or interactions

  • Membrane topology mapping:

    • Cysteine accessibility scanning to identify transmembrane regions

    • Protease protection assays to determine cytoplasmic vs. extracellular domains

    • Fluorescence microscopy with GFP fusions at different positions

  • Interaction interface mapping:

    • Cross-linking mass spectrometry to identify LrgA-LrgB contact points

    • Hydrogen-deuterium exchange to detect conformational changes upon complex formation

    • Mutagenesis studies targeting predicted interaction sites

  • Conformational dynamics:

    • Molecular dynamics simulations in membrane environments

    • Single-molecule FRET to detect state transitions

    • EPR spectroscopy to measure distances between domains

These structural studies would provide crucial insights into how LrgB functions at the molecular level and how it integrates into the larger cellular machinery controlling cell death and biofilm formation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.