Recombinant Bacillus cereus subsp. cytotoxis Holin-like protein CidA (cidA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus cereus subsp. cytotoxis Holin-like protein CidA (cidA)

Recombinant Bacillus cereus subsp. cytotoxis Holin-like protein CidA (cidA) is a protein expressed in E. coli and fused to an N-terminal His tag . CidA, a holin-like protein, is part of a family of proteins involved in programmed cell death (PCD) . These proteins, including Staphylococcus aureus CidA and LrgA, have structural similarities to bacteriophage holins and are thought to function by forming pores within the cytoplasmic membrane .

Functional Studies

  • Holin-like Activity The cidA and lrgA genes can support bacteriophage endolysin-induced cell lysis, typical of holins . Lysis induced by CidA and LrgA depends on the coexpression of endolysin .

  • Membrane Localization and Pore Formation CidA and LrgA proteins localize to the surface of membrane vesicles and cause leakage of small molecules, suggesting their potential to form pores . Expression of CidA or LrgA in E. coli results in their accumulation within the cytoplasmic membrane, leading to pore formation that allows the passage of the ∼18-kDa endolysin .

  • Regulation of Cell Death Mutations in cid and lrg genes can alter murein hydrolase activity and autolysis, indicating their role in regulating PCD . These genes are well-conserved in bacteria, Archaea, and plants and are crucial in biofilm development, where PCD benefits the population .

Role in Carbohydrate Metabolism

LrgAB is important for S. aureus to utilize pyruvate during microaerobic and anaerobic growth by promoting pyruvate uptake under these conditions .

Regulation of cidABC Expression in Staphylococcus aureus

  • CidR and CcpA Regulation Expression of the cidABC operon in S. aureus is synergistically controlled by transcriptional regulators CidR and CcpA during carbohydrate metabolism . Full induction of cidABC expression depends on the metabolic state of bacteria and requires both CidR and CcpA .

  • CidR Binding CidR directly regulates cidABC expression by binding to a 12-bp nucleotide sequence (TAGTAATACAAA) .

  • CcpA Binding CcpA directly binds within the cidABC promoter region, positively regulating cidABC expression .

CidA and LrgA in Biofilm Development

The biological role of cid/ lrg genes is associated with biofilm development, a multicellular context in which PCD can provide a benefit to the population .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cidA; Bcer98_2321; Holin-like protein CidA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Target Names
cidA
Target Protein Sequence
MKWWKLSGQILLLFCFAWTGEWIAKQVHLPIPGSIIGIFLLLISLKFNLVKKEWIQDGAD FLLKELILFFIPSAVAVIRYKDTLSQYGIDLIFIIMISTLCVTLVTGILTELLLKRKGSV Q
Uniprot No.

Target Background

Function

CidA, a holin-like protein from Bacillus cereus subsp. cytotoxis, enhances the activity of extracellular murein hydrolases, potentially by facilitating their export through membrane pore formation. Its function is inhibited by the antiholin-like proteins LrgAB. Under normal conditions, LrgAB likely inhibits CidA activity. However, cellular stress (e.g., antibiotic exposure) may induce CidA oligomerization within the bacterial membrane, creating lesions that disrupt the proton motive force, leading to cell death. These lesions are also thought to regulate cell lysis by providing murein hydrolases access to the cell wall or by altering cell wall pH due to the loss of membrane potential.

Database Links
Protein Families
CidA/LrgA family, CidA subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CidA and how does it relate to bacterial programmed cell death?

CidA is a member of a well-conserved family of proteins involved in programmed cell death (PCD) in bacteria. Based on structural similarities with bacteriophage holins, CidA functions by forming pores within the cytoplasmic membrane. Research has demonstrated that CidA can support bacteriophage endolysin-induced cell lysis, consistent with its proposed holin-like functions . The cidA gene is part of the cidABC operon, which works in concert with the lrgAB operon to regulate cell death and lysis in bacterial populations . These proteins play critical roles in biofilm development, providing a context in which programmed cell death could benefit the bacterial population as a whole .

What structural features are characteristic of CidA protein?

CidA shares several key structural features with bacteriophage holins, including:

  • Small size (typically containing two or three transmembrane domains)

  • A highly charged C-terminal domain

  • A polar N-terminus

  • Ability to form dimers and oligomerize into high-molecular-mass structures in vitro

  • Dependence on cysteine disulfide bonds for oligomerization, similar to the S105 holin

These structural features directly relate to the protein's membrane-permeabilizing function, allowing it to form pores that facilitate the transport of molecules across the bacterial membrane.

How do the functional properties of CidA relate to bacterial metabolism?

Recent research has shown that CidA possesses holin-like properties that play an important role in the transport of small by-products of carbohydrate metabolism . CidA has been demonstrated to localize to the surface of membrane vesicles and cause leakage of small molecules, providing direct evidence of its hole-forming potential . This function suggests a dual role for CidA both in programmed cell death and in metabolic regulation, particularly under changing environmental conditions such as oxygen limitation that bacteria might encounter in natural environments like the gastrointestinal tract .

What are effective approaches for expressing recombinant CidA protein?

For recombinant expression of CidA from B. cereus, researchers should consider the following methodology:

  • Gene cloning using reverse transcription-PCR from B. cereus bacterial cultures

  • Construction of an expression vector with the cidA gene, preferably using a T7 RNA polymerase-T7 promoter expression system similar to that used for other B. cereus proteins

  • Addition of a detection tag such as a strep tag (biotin-like peptide) at the C-terminus to facilitate protein detection and purification

  • Expression in E. coli, followed by protein purification using affinity chromatography

This approach allows for high-yield production of functional recombinant protein while maintaining the structural integrity necessary for experimental applications.

What detection methods are most reliable for CidA identification and characterization?

Several complementary techniques can be employed for reliable detection and characterization of CidA:

  • Western blot analysis using:

    • Streptavidin-conjugated enzyme systems (if using a strep tag)

    • Anti-His antibodies (if using a histidine tag)

    • Specific antibodies raised against CidA

  • Gel filtration chromatography to isolate monomeric forms of the protein

  • Functional assays:

    • Membrane vesicle leakage assays using synthetic vesicles composed of phospholipids like POPG

    • Bacteriophage endolysin-induced cell lysis assays to confirm holin-like activity

These methodologies provide complementary data on both the molecular characteristics and functional properties of CidA.

How can researchers effectively assess CidA's pore-forming activity?

To evaluate the pore-forming capacity of CidA, researchers should implement a multi-faceted approach:

  • In vitro protein-induced leakage assay: Recombinant CidA can be reconstituted with synthetic phospholipid vesicles to measure membrane permeabilization . This involves:

    • Preparation of monomeric CidA-His by gel filtration

    • Confirmation of purity by SDS-PAGE and Western blot analysis

    • Reconstitution with phospholipid vesicles containing fluorescent dyes

    • Measurement of dye leakage as an indicator of pore formation

  • Lysis cassette system: This approach tests the ability of cidA to support bacteriophage endolysin-induced cell lysis, typical of true holin function .

  • Membrane localization studies: Using fluorescently tagged CidA to visualize its localization to membrane vesicles .

These assays provide comprehensive data on the pore-forming capabilities and biological relevance of CidA activity.

How does CidA contribute to B. cereus virulence mechanisms?

While direct evidence for CidA's role in B. cereus virulence is still emerging, insights can be drawn from related research:

B. cereus is known for causing food-borne illness and can grow at refrigeration temperatures . The bacterium's pathogenicity involves multiple factors, including enterotoxins and hemolytic factors . Though not directly implicated in the search results, CidA's membrane-permeabilizing activity could potentially:

  • Enhance the delivery of other toxins by compromising host cell membranes

  • Contribute to bacterial adaptation in host environments

  • Play a role in biofilm formation, which is associated with increased virulence

This hypothesis is supported by observations in S. aureus, where alterations in murein hydrolase activity and autolysis were observed in cid mutants , suggesting a broader role in cell wall integrity that could influence pathogenicity.

How is CidA expression affected by environmental conditions?

Environmental factors, particularly oxygen availability, significantly influence B. cereus protein expression patterns:

B. cereus adapts its metabolism and regulates its proteome in response to changes in oxygen pressure . Since B. cereus infections typically occur in anoxic or hypoxic conditions such as those in the gastrointestinal tract, the expression of virulence factors like CidA is likely to be influenced by these conditions .

In parallel observations, certain B. cereus strains demonstrate increased toxicity in microaerobic (oxygen-limited) environments , and similar regulation might apply to CidA expression. This environmental responsiveness is particularly relevant when studying CidA's role in natural infection settings rather than standard laboratory conditions.

What is known about potential interactions between CidA and other B. cereus virulence factors?

B. cereus possesses numerous virulence factors that might interact with CidA:

  • Enterotoxins: B. cereus produces enterotoxins like the Nhe complex, which requires specific binding order of its components (NheA, NheB, and NheC) for cytotoxicity . While direct interaction with CidA has not been established, the membrane-permeabilizing effect of CidA could potentially enhance enterotoxin activity.

  • Pore-forming toxins: B. cereus produces cereolysin O (CLO), a cholesterol-dependent hemolysin . The combined effect of pore-forming toxins and metabolic products contributes to B. cereus cytotoxicity , suggesting potential functional overlap or synergy with CidA.

  • Flagellar proteins: B. cereus motility, which depends on flagella, is a factor in its ability to cause diarrheal disease . The relationship between motility and membrane protein function represents an area for further research.

What are the current technical challenges in studying CidA structure-function relationships?

Researchers face several obstacles when investigating CidA:

  • Membrane protein purification: As a membrane protein with multiple transmembrane domains, CidA presents challenges for expression, purification, and structural studies. Maintaining proper folding and function during purification requires specialized approaches.

  • Functional reconstitution: Assessing pore formation often requires reconstitution in artificial membrane systems, which may not fully replicate the native bacterial membrane environment .

  • Strain variation: B. cereus strains exhibit significant variation in virulence factor expression , potentially complicating the study of CidA across different isolates.

  • Conditional expression: The environmental regulation of CidA expression adds complexity to experimental design, as laboratory conditions may not reflect the natural settings where CidA function is most relevant .

Addressing these challenges requires integrated experimental approaches combining molecular biology, biochemistry, and advanced structural biology techniques.

How might CidA function in biofilm formation and persistence?

CidA's potential role in biofilm development represents an important research area:

The cidABC operon has been associated with biofilm development in S. aureus, providing a multicellular context in which programmed cell death could benefit the population . In biofilms, limited nutrient and oxygen availability create microenvironments where the transport functions of CidA might be particularly important.

The ability of CidA to facilitate the transport of small by-products of carbohydrate metabolism could be crucial for:

  • Nutrient sharing within biofilm communities

  • Adaptation to the hypoxic conditions often found in biofilm interiors

  • Contributing to the extracellular matrix composition through controlled release of cellular components

These functions may contribute to B. cereus persistence in both environmental and clinical settings.

What experimental models best simulate natural B. cereus infection conditions for studying CidA?

To study CidA under physiologically relevant conditions, researchers should consider:

  • Microaerobic culture systems: Since B. cereus infections typically occur in oxygen-limited environments, studies under microaerobic conditions more accurately reflect natural settings . Some B. cereus strains show increased toxicity upon oxygen limitation .

  • Host cell interaction models: Human lung epithelial cell models have been used to assess B. cereus cytotoxicity and could be adapted to study CidA's role in host-pathogen interactions.

  • Environmental stress conditions: Simulating conditions that B. cereus encounters during infection, such as varying pH, nutrient limitation, and host defense molecules, provides more relevant insights into CidA function.

  • Animal infection models: For in vivo relevance, animal models that reproduce the pathology of B. cereus infections can evaluate the contribution of CidA to virulence.

How does B. cereus CidA compare to homologous proteins in other bacterial species?

The CidA protein belongs to a well-conserved family found across bacterial species:

FeatureB. cereus CidAS. aureus CidAOther Species
Structural elementsSmall, 2-3 transmembrane domainsSmall, 2-3 transmembrane domains, charged C-terminal domain Conserved across bacteria and in Archaea and plants
FunctionPresumed pore formation and metabolite transportPore formation, transport of carbohydrate metabolism by-products Similar roles in controlled lysis and metabolite transport
OligomerizationLikely forms oligomeric structuresForms dimers and higher-order oligomers dependent on cysteine disulfide bonds Variable oligomerization mechanisms
RegulationLikely environmentally regulatedPart of the cidABC operon with complex regulationSpecies-specific regulatory mechanisms

This conservation across species highlights the evolutionary importance of CidA-like proteins in bacterial physiology.

What distinguishes CidA from other membrane-permeabilizing proteins in B. cereus?

B. cereus produces several membrane-active proteins with distinct characteristics:

  • CidA vs. Cereolysin O (CLO): While both can permeabilize membranes, CLO is a cholesterol-dependent hemolysin that specifically targets cholesterol-containing membranes. In contrast, CidA likely forms more general pores without cholesterol dependence.

  • CidA vs. Nhe complex components: The Nhe enterotoxin requires three proteins (NheA, NheB, NheC) in a specific binding order for toxicity , whereas CidA appears to function independently or with fewer interaction partners.

  • CidA vs. other holins: Unlike typical phage holins that function primarily in the lysis timing of phage infection, CidA has adapted to serve in bacterial metabolism and potentially programmed cell death .

These distinctions highlight the specialized role of CidA within B. cereus' arsenal of membrane-active proteins.

What emerging technologies might advance our understanding of CidA function?

Several cutting-edge approaches hold promise for CidA research:

  • Cryo-electron microscopy: For determining the high-resolution structure of CidA oligomers in membrane environments, revealing the molecular basis of pore formation.

  • Single-molecule techniques: To study the dynamics of CidA pore formation and substrate transport in real-time.

  • Genome editing with CRISPR-Cas9: For precise manipulation of the cidA gene to study structure-function relationships in B. cereus.

  • Systems biology approaches: To understand how CidA integrates into broader cellular networks, particularly under varying environmental conditions.

These technologies could overcome current limitations in studying membrane protein structure and function.

How might functional insights into CidA inform strategies against B. cereus infections?

Understanding CidA function could lead to novel control strategies:

  • Targeted inhibitors: Development of molecules that specifically block CidA pore formation could potentially reduce B. cereus virulence or survival.

  • Environmental interventions: Knowledge of how oxygen availability affects CidA expression might inform food safety measures to control B. cereus growth and toxin production.

  • Cross-species applications: Insights from B. cereus CidA could inform approaches to other pathogens with homologous proteins, including closely related B. anthracis .

The conservation of CidA across bacterial species suggests that strategies targeting this protein might have broad applications in controlling bacterial infections and biofilms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.