Recombinant Bacillus cereus subsp. cytotoxis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus cereus subsp. cytotoxis Large-Conductance Mechanosensitive Channel (MscL)

The mechanosensitive channel of large conductance (MscL) serves as a crucial safety valve in bacteria, protecting them from osmotic downshock by opening a pore in the membrane to release cytoplasmic solutes . When the cell membrane is stretched, MscL responds by opening a nonselective pore, allowing ions, water, metabolites, and even small proteins to pass through . This channel has a large unitary conductance of approximately 3 nS .

MscL is one of two primary classes of mechanosensitive channels found in microbes, with the other being MscS (which includes MscS, MscK, and MscM) . MscL exhibits the largest conductance, around 3 nS when fully open, and it activates at the highest pressure threshold, near the point where the cell membrane would rupture .

Structure and Function of MscL

MscL, similar to other ion channels, assembles as a symmetric oligomer, where subunits arrange around a central axis to form a permeation pathway . While MscS is heptameric, MscL is thought to be pentameric . Each MscL subunit contains two transmembrane helices arranged in an up-down/nearest neighbor configuration . The channel's pore is funnel-shaped, wider at the periplasmic surface and narrower near the cytoplasm, with the narrowest point constricted by the side chains of specific residues . When open, the pore can reach a diameter of approximately 3 nm, allowing passage of small proteins up to 9 kDa .

  • Each subunit of Escherichia coli MscL (Ec-MscL) consists of 136 amino acids and crosses the membrane twice via alpha-helical transmembrane segments M1 and M2, connected by an extracellular loop .

  • The M1 helices form the main gate of the mechanosensitive channel, with regularly spaced glycine residues allowing tight packing and forming a narrow hydrophobic constriction .

  • Hydrophobic M2 helices are located on the periphery, facing the lipid bilayer .

  • The M1 helix of one subunit makes tight contact with the M2 helix of an adjacent subunit, further stabilized by a salt bridge in Ec-MscL, securing the complex .

MscL in Bacillus cereus

In Bacillus cereus, MscL channels are believed to be involved in the export of elongation factor Tu (EfTu), a moonlighting protein, across the bacterial membrane . Berrier et al. suggested that EfTu could be exported through E. coli membranes via large mechanosensitive channels (MscL) under osmotic shock .

Modulation and Inhibition of MscL

Gadolinium chloride (GdCl3) can inhibit mechanosensitive channels, particularly MscL . Studies have shown that GdCl3 inhibits EfTu export in B. cereus, suggesting that EfTu export is dependent on active mechanosensitive channels like MscL . Furthermore, GdCl3 has been shown to inhibit the increase of cytotoxicity and biofilm formation induced by Substance P in B. cereus, indicating that functional mechanosensitive channels are required for the response of B. cereus to Substance P .

MscL as an Antibiotic Target

MscL is considered a potential antibiotic target because inappropriate opening of its large pore can be detrimental to the cell . Researchers have identified compounds that slow growth in an MscL-dependent manner, confirming that MscL is a viable antibiotic target and providing insights into its gating mechanisms .

Research Findings

StudyFindings
GdCl3 Inhibition of MscL in B. cereus GdCl3 inhibits EfTu export, suggesting EfTu export depends on active mechanosensitive channels and inhibits the increase of cytotoxicity and biofilm formation induced by Substance P in B. cereus, indicating that functional mechanosensitive channels are required.
MscL Modulation by Novel Compounds Novel sulfonamide compounds can modulate MscL, increasing its gating activity. These compounds bind in a pocket where an α-helix interacts with a neighboring subunit, suggesting that MscL is a viable antibiotic target.
MscL Structure and Function The MscL channel responds to membrane stretching by opening a nonselective pore, allowing ions, water, metabolites, and small proteins to pass through. MscL has a large unitary conductance of approximately 3 nS.
MscL Structure MscL is organized as symmetric oligomers with a permeation pathway formed by the packing of subunits. The channel's pore is funnel-shaped, wider at the periplasmic surface, narrower near the cytoplasm, and constricted by the side chains of specific residues.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; Bcer98_3340; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Target Names
mscL
Target Protein Sequence
MWNEFKKFALKGNVMDLAVGVVIGGAFGKIVSSLVSDVIMPLVGLLLGGVNFTGLSFTFG KAVVKYGAFIQTVVDFLIIAFSIFLFIKLFNKLTFKKEEEKKEEVPEPTKEEVLLGEIRD LLKQQNASKDRA
Uniprot No.

Target Background

Function

This channel opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating intracellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the physiological role of MscL in Bacillus cereus?

MscL functions as an emergency release valve in B. cereus, preventing cell lysis during acute osmotic downshock by relieving excess turgor pressure in response to increased membrane tension. This channel opens in response to membrane stretching, creating a non-selective pore approximately 30 Å wide with a large unitary conductance of ~3 nS to discharge cytoplasmic solutes when bacteria experience hypoosmotic conditions . This mechanism is essential for bacterial survival in dynamic environments that undergo rapid osmotic changes.

How does B. cereus MscL compare with MscL from other bacterial species?

While MscL is highly conserved across bacteria, there are notable structural and functional differences between species. For example, comparative analysis between Bacillus cereus MscL and the better-characterized Mycobacterium tuberculosis MscL (MtMscL) shows that they share the pentameric architecture but may differ in tension sensitivity and conductance properties. Studies of truncated forms like MtMscLΔC demonstrate that the C-terminal domain influences tension sensitivity rather than being essential for oligomerization . B. cereus MscL likely shares these fundamental properties but may have unique strain-specific characteristics affecting its gating threshold and conductance patterns.

What are the key structural elements of B. cereus MscL?

The B. cereus MscL structure contains multiple domains with distinct functions in the gating process:

  • Two transmembrane helices (TM1 and TM2) that undergo significant tilting during channel opening

  • A periplasmic loop region that transforms from a folded structure to an extended conformation during expansion

  • An N-terminal helix that serves as a membrane-anchored stopper limiting the tilts of TM1 and TM2

  • A cytoplasmic C-terminal domain that influences tension sensitivity and conductance properties

This structural arrangement allows for the highly coordinated movement necessary for channel function during osmotic stress response.

What expression systems are most effective for producing recombinant B. cereus MscL?

E. coli expression systems are the most commonly used for recombinant MscL production, as evidenced by commercial recombinant B. cereus MscL being sourced from E. coli . When designing expression constructs, researchers should consider:

  • Codon optimization for the expression host

  • Inclusion of appropriate tags (His-tag is commonly used) for purification

  • Careful selection of promoter systems (T7 promoter-based systems have shown good results)

  • Expression temperature optimization (typically 18-25°C for membrane proteins to prevent inclusion body formation)

For functional studies, it's critical to ensure proper membrane insertion of the recombinant protein, often requiring specialized E. coli strains designed for membrane protein expression.

What are the challenges in purifying functional recombinant B. cereus MscL?

Purification of functional MscL presents several technical challenges:

  • Membrane protein solubilization requires careful detergent selection; n-dodecyl-β-D-maltopyranoside (DDM) has been successfully used for MscL homologs

  • Maintaining protein stability during extraction and purification steps

  • Ensuring pentameric assembly remains intact during purification

  • Removing aggregates while preserving native oligomeric state

A typical purification protocol includes:

  • Membrane fraction isolation by ultracentrifugation

  • Solubilization in appropriate detergent (DDM or similar)

  • Affinity chromatography (if tagged protein)

  • Size exclusion chromatography to separate different oligomeric states

  • Quality control by SDS-PAGE and functional assays

For storage, addition of 5-50% glycerol and aliquoting for long-term storage at -20°C/-80°C is recommended, with shelf life typically being 6 months for liquid form and 12 months for lyophilized form .

What electrophysiological approaches can be used to characterize B. cereus MscL gating properties?

Patch-clamp electrophysiology is the gold standard for characterizing MscL function. Key methodological considerations include:

  • Patch Configuration: Cell-attached or excised patch (inside-out or outside-out) configurations can be used, with excised patches offering better control of conditions on both sides of the membrane.

  • High-Resolution Recording: Optimized patch-clamp setups for low-noise recordings at a time resolution of 3 μs (10-20 times faster than typical) are essential for resolving temporal details of conductance transitions .

  • Pressure Application Protocol:

    • Calibrated suction pressures should be applied to activate the channel

    • Pressure protocols should include both step and ramp pressure applications

    • Pressure thresholds should be determined for multiple activation events to establish consistency

  • Data Analysis Parameters:

    • Channel conductance (typically in the range of 3 nS for full conductance)

    • Subconductance states identification

    • Transition kinetics between states

    • Tension sensitivity (pressure threshold for activation)

    • Open probability as a function of membrane tension

Recent studies have shown that MscL channels visit multiple subconductance states during gating, and transitions between states occur on the microsecond timescale, requiring specialized recording equipment for proper resolution .

How can liposome-based assays be used to study B. cereus MscL function?

Liposome-based assays provide alternative approaches to study MscL function:

  • Fluorescence-Based Efflux Assays:

    • Liposomes are loaded with self-quenching fluorescent dyes (carboxyfluorescein)

    • Channel activation leads to dye release and increased fluorescence

    • This system allows high-throughput screening of channel activators or modulators

  • Stopped-Flow Spectroscopy:

    • Measures rapid kinetics of solute efflux through MscL channels

    • Can determine rate constants for channel opening and closing

  • Cryo-EM Analysis of Reconstituted Channels:

    • Visualizes structural changes in different conformational states

    • Can be combined with site-directed spin labeling for dynamic studies

  • Light-Activated MscL Systems:

    • MscL can be converted into light-activated nanovalves for triggered release experiments

    • These systems allow precise temporal control of channel activation

When preparing proteoliposomes, careful consideration of lipid composition is essential as membrane properties strongly influence MscL gating properties.

What methods are available for determining the structure of recombinant B. cereus MscL?

Several structural biology techniques can be applied to characterize B. cereus MscL:

  • X-ray Crystallography:

    • Has been successfully used for MscL from other species

    • Requires high-purity, stable protein preparations

    • Detergent choice is critical for crystal formation

    • Can reveal high-resolution details of the closed state

  • Cryo-Electron Microscopy (Cryo-EM):

    • Increasingly popular for membrane protein structure determination

    • Can capture different conformational states

    • Doesn't require crystallization

  • Site-Directed Spin Labeling (SDSL) with EPR Spectroscopy:

    • Can track conformational changes during gating

    • Provides information about dynamic properties

    • Has been used to verify and revise MscL gating models

  • Native Ion Mobility-Mass Spectrometry:

    • Demonstrates structural flexibility of MscL even in the absence of lipid bilayer

    • Provides insights into oligomeric assembly

  • Computational Modeling:

    • The Spencer-Rees equation has been used to calculate theoretical expanded-state models of MscL

    • Molecular dynamics simulations can predict channel behavior under tension

Key structural parameters to analyze include:

  • Tilt angles of transmembrane helices

  • Crossing angles between helices

  • Pore dimensions using programs like HOLE

  • Subunit interactions that stabilize different conformational states

How can computational methods enhance our understanding of B. cereus MscL structure-function relationships?

Computational approaches provide valuable insights into MscL function:

  • Molecular Dynamics (MD) Simulations:

    • Simulate channel behavior under membrane tension

    • Predict intermediate conformational states during gating

    • Identify key residues involved in mechanosensation

  • Homology Modeling:

    • Generate B. cereus MscL models based on known structures from other species

    • Predict strain-specific structural variations

  • Free Energy Calculations:

    • Estimate energetics of conformational transitions

    • Identify energy barriers in the gating pathway

  • Elastic Network Models:

    • Analyze collective motions associated with channel opening

    • Identify mechanical coupling between different domains

The iris-like opening model of MscL gating, first proposed based on computational modeling, has been experimentally validated and refined through multiple techniques , demonstrating the value of computational approaches.

What strategies can be employed for site-directed mutagenesis of B. cereus MscL to study structure-function relationships?

Site-directed mutagenesis offers powerful insights into MscL function:

  • Key Targets for Mutagenesis:

    • The N-terminal region contains epitopes critical for swimming motility in B. cereus

    • The consensus motif N-h-h-D (where h represents hydrophobic amino acids) is functionally important across channel families

    • Residues at the transmembrane helix interfaces affect gating tension sensitivity

  • Functional Mutation Types:

    • Gain-of-function mutations: Lower gating threshold

    • Loss-of-function mutations: Increase gating threshold or block function

    • Reporter mutations: Introduce cysteines for fluorescent labeling or crosslinking

  • Experimental Approaches:

    • Disulfide cross-linking to test proximity of residues in different states

    • Introduction of charged residues for electrostatic repulsion tests

    • Conservative vs. non-conservative substitutions to test specific interactions

Mutation data should be analyzed in context of both structural models and functional assays to develop comprehensive understanding of how specific residues contribute to channel function.

How can CRISPR-Cas9 technologies be applied to study B. cereus MscL in its native context?

CRISPR-Cas9 approaches enable precise genetic manipulation of B. cereus:

  • Knockout Studies:

    • Generate MscL-deficient strains to assess physiological importance

    • Create conditional knockouts for essential genes

    • Examine phenotypic consequences under osmotic stress

  • Knock-in Applications:

    • Introduce tagged versions for localization studies

    • Generate point mutations to study specific residues

    • Create reporter fusions for expression analysis

  • Technical Considerations:

    • Optimization of transformation protocols for B. cereus

    • Selection of appropriate guide RNAs with minimal off-target effects

    • Use of temperature-sensitive plasmids for controlled expression

    • Verification of genetic modifications through sequencing

Such genetic approaches can reveal strain-specific variations in MscL function, which is particularly relevant as B. cereus strains show significant differences in their pathogenicity and stress responses.

How can recombinant B. cereus MscL be utilized for mechano-sensitization of mammalian cells?

Heterologous expression of MscL enables novel mechano-sensitization applications:

  • Neuronal Mechano-sensitization:

    • Expression of bacterial MscL in mammalian neuronal networks creates mechanically sensitive neurons

    • This approach has been validated through patch-clamp recordings upon application of calibrated suction pressures

    • Engineered MscL can be expressed in neurons without disrupting network development, synaptic connections, or spontaneous activity

  • Experimental Design Considerations:

    • Codon optimization for mammalian expression

    • Selection of appropriate promoters (neuron-specific promoters for targeted expression)

    • Assessment of cell viability and functionality post-expression

    • Calibration of mechanical stimuli to achieve desired responses

  • Advantages:

    • Pure mechanosensitivity without chemical or temperature sensitivity

    • Wide genetic modification library enables customization

    • Can be combined with other techniques for multimodal control

    • Potential for remote, non-invasive stimulation of neuronal circuits

This approach represents a versatile tool for developing mechano-genetic techniques for basic research and potentially therapeutic applications .

What are the considerations for using B. cereus MscL in drug delivery systems?

MscL channels have potential applications in controlled release systems:

  • Liposome-Based Drug Delivery:

    • MscL can be reconstituted in liposomes as triggerable release mechanisms

    • Can be converted into light-activated nanovalves for triggered compound release

    • Pressure or tension-based release mechanisms for targeted delivery

  • Design Parameters:

    • Channel density in liposomes affects release kinetics

    • Liposome composition influences channel gating properties

    • Payload size must be compatible with channel pore dimensions (~30 Å)

  • Target Applications:

    • Release of small molecule drugs, ions, metabolites

    • Potential delivery vehicle for antimicrobial agents (relevant as MscL permits entry of compounds like streptomycin)

    • Controlled release of signaling molecules in research applications

  • Engineering Approaches:

    • Modification of gating threshold through mutagenesis

    • Addition of stimulus-responsive elements (light, pH, temperature)

    • Conjugation with targeting molecules for site-specific delivery

The unique properties of MscL, including its large conductance and controllable gating, make it an attractive candidate for developing sophisticated drug delivery systems.

How does MscL affect B. cereus susceptibility to antibiotics?

MscL can influence antibiotic efficacy in several ways:

  • Transport Pathway:

    • The open pore of MscL permits entry of certain antibiotics such as streptomycin

    • This creates a potential pathway for antibiotics to enter bacterial cells

    • The ~30 Å pore size theoretically allows passage of many common antibiotics

  • Strain-Specific Variations:

    • B. cereus strains show variable resistance to clinical antibiotics

    • MscL structure and expression levels may contribute to these differences

    • Single nucleotide polymorphisms (SNPs) identified in B. cereus can affect strain cytotoxicity and potentially antibiotic responses

  • Research Applications:

    • MscL can potentially serve as a target for antimicrobial agents

    • Channel-opening compounds could be used to increase bacterial membrane permeability

    • Combination therapies targeting MscL and other cellular processes could enhance efficacy

  • Experimental Approaches:

    • Antibiotic susceptibility testing of wild-type vs. MscL-deficient strains

    • Assessment of antibiotic accumulation in cells with normal vs. modified MscL

    • Screening for compounds that specifically interact with MscL to alter antibiotic uptake

Understanding these interactions could lead to new strategies for combating B. cereus infections, which are resistant to several clinical antibiotics.

Can MscL-specific antibodies modulate channel function in B. cereus?

Antibodies targeting MscL can affect cellular functions:

  • Observed Effects:

    • Monoclonal antibodies (e.g., mAb 1A11) recognizing epitopes in the N-terminal region of flagellin have been shown to inhibit bacterial swimming motility

    • Polyclonal sera can affect bacterial growth in certain B. cereus strains

  • Potential Mechanisms:

    • Direct blockade of channel pore

    • Inhibition of conformational changes required for gating

    • Alteration of membrane properties around the channel

    • Interference with protein-protein interactions

  • Experimental Approaches:

    • Development of monoclonal antibodies against specific MscL epitopes

    • Electrophysiological assessment of channel function in the presence of antibodies

    • Growth and survival assays under osmotic stress with and without antibodies

    • Evaluation of antibody binding to different conformational states

  • Research Applications:

    • Tools for studying MscL structure and function

    • Potential therapeutic approaches targeting bacterial osmoregulation

    • Markers for specific B. cereus strains based on MscL variations

Such immunological approaches provide additional tools for studying and potentially manipulating MscL function in research and therapeutic contexts.

How should subconductance states in B. cereus MscL electrophysiological recordings be analyzed?

Analysis of MscL subconductance states requires sophisticated approaches:

  • High-Resolution Recording Requirements:

    • Time resolution of 3 μs or better is needed to resolve temporal details of conductance transitions

    • Low-noise recording setups are essential to distinguish true subconductance states from noise

  • Analytical Methods:

    • Hidden Markov modeling to identify discrete states

    • Idealization of single-channel recordings

    • Transition probability analysis between states

    • Dwell time analysis for each conductance level

  • Key Parameters to Extract:

    • Number of distinct subconductance states

    • Conductance value of each state (as fraction of full conductance)

    • Transition rates between states

    • Pressure dependence of state occupancy

  • Interpretation Framework:

    • Each subconductance state likely represents a distinct conformational state of the channel

    • The temporal sequence of states provides insight into the gating pathway

    • Comparison with structural models can link conductance states to specific conformational changes

Analysis has revealed that MscL visits many subconductance states, and transitions between states occur more slowly than 3 μs, with larger transitions taking longer times . These findings suggest a complex, multi-step gating mechanism.

What statistical approaches are appropriate for analyzing strain-specific variations in B. cereus MscL properties?

Statistical analysis of strain variation requires rigorous approaches:

  • Comparative Methods:

    • Analysis of variance (ANOVA) to compare properties across multiple strains

    • Post-hoc tests (e.g., Tukey's HSD) to identify specific strain differences

    • Multivariate analysis to examine correlations between multiple parameters

  • Sequence-Function Correlations:

    • Logistic and random forest regression models to identify predictive markers

    • Identification of single nucleotide polymorphisms (SNPs) that correlate with functional differences

    • Calculation of sensitivity, specificity, accuracy, and precision values for predictive markers

  • Strain Grouping Approaches:

    • Phylogenetic analysis based on MscL sequence

    • Functional clustering based on electrophysiological properties

    • Classification based on structural variations

  • Data Presentation Standards:

    • Clear reporting of statistical tests and significance levels

    • Appropriate visualization of strain differences (box plots, heat maps)

    • Inclusion of raw data or access to repositories

Recent studies of B. cereus have identified SNPs within key genes that serve as more effective predictors of strain properties than mere gene presence, with accuracy and precision values exceeding 0.7 . Similar approaches could be applied to MscL variations.

What are the common challenges in functional reconstitution of recombinant B. cereus MscL?

Functional reconstitution faces several technical challenges:

  • Protein Aggregation Issues:

    • Symptoms: Poor incorporation into liposomes, non-functional channels

    • Solutions: Optimize detergent:protein ratio, use fresh preparations, screen different detergents

  • Low Channel Activity:

    • Symptoms: Few active channels in patch-clamp recordings

    • Solutions: Verify protein quality by SDS-PAGE, optimize reconstitution protocol, adjust protein:lipid ratio

  • Non-specific Leakage:

    • Symptoms: Baseline leakage in liposomes without applied tension

    • Solutions: Check liposome quality, reduce detergent concentration during reconstitution, optimize buffer conditions

  • Irregular Gating Behavior:

    • Symptoms: Unusual conductance patterns, inconsistent responses to pressure

    • Solutions: Verify membrane composition, check for protein modifications, control experimental temperature

  • Poor Reproducibility:

    • Symptoms: Large variations between experiments

    • Solutions: Standardize protein preparation and reconstitution protocols, control lipid lot variability, establish clear quality control criteria

A methodical approach to troubleshooting, with careful documentation of conditions and outcomes, is essential for achieving consistent results.

How can researchers address inconsistencies between electrophysiological and biochemical data in MscL studies?

Resolving data inconsistencies requires systematic investigation:

  • Common Sources of Discrepancy:

    • Different lipid environments affecting channel properties

    • Protein modifications during preparation (oxidation, proteolysis)

    • Tag interference with channel function

    • Temperature and buffer differences between assays

  • Reconciliation Strategies:

    • Perform both types of experiments under matched conditions where possible

    • Use multiple complementary techniques to verify key findings

    • Develop internal controls to calibrate between different experimental systems

    • Consider native vs. recombinant protein differences

  • Critical Controls:

    • Known gain-of-function and loss-of-function mutants as reference points

    • Parallel testing of well-characterized MscL homologs (E. coli MscL)

    • Empty liposome controls for biochemical assays

    • Patch-clamp recordings of native membranes when possible

  • Integrated Analysis Framework:

    • Develop models that account for differences in experimental conditions

    • Establish quantitative relationships between results from different techniques

    • Use computational approaches to bridge gaps between structural and functional data

By systematically addressing these issues, researchers can develop a more coherent understanding of MscL structure and function across different experimental platforms.

What are emerging technologies that could advance B. cereus MscL research?

Several cutting-edge approaches show promise for advancing MscL research:

  • Single-Molecule Techniques:

    • High-speed atomic force microscopy (HS-AFM) for visualizing conformational changes in real-time

    • Single-molecule FRET to track protein dynamics during gating

    • Nanodiscs for studying channels in defined lipid environments

  • Advanced Structural Methods:

    • Time-resolved cryo-EM to capture intermediate states during gating

    • Micro-electron diffraction for structure determination of small crystals

    • In-cell structural studies using techniques like DEER spectroscopy

  • Hybrid Approaches:

    • Combining computational models with experimental constraints

    • Integrating structural, functional, and dynamical data

    • Multi-scale modeling to link atomic details to cellular functions

  • Genetic Technologies:

    • CRISPR interference for precise control of expression levels

    • Optogenetic control of MscL expression or function

    • Deep mutational scanning to comprehensively map sequence-function relationships

These technologies could provide unprecedented insights into the dynamic behavior of MscL and its role in bacterial osmoregulation.

How might B. cereus MscL research contribute to development of novel antimicrobial strategies?

MscL research has potential implications for antimicrobial development:

  • Channel-Targeting Approaches:

    • Compounds that lock MscL in open state to disrupt osmotic balance

    • Molecules that alter gating threshold to sensitize bacteria to osmotic changes

    • Peptides that block channel function under specific conditions

  • Delivery Strategies:

    • MscL-mediated delivery of antimicrobial compounds into bacteria

    • Combination therapies targeting MscL and other cellular processes

    • Strain-specific approaches based on MscL sequence variations

  • Diagnostic Applications:

    • Detection of strain-specific MscL variants as markers for pathogenicity

    • Rapid assessment of strain properties based on MscL characteristics

    • Monitoring of resistance development through MscL modifications

  • Research Directions:

    • High-throughput screening for MscL-interacting compounds

    • Structure-based design of channel modulators

    • Development of strain-specific targeting strategies based on SNP patterns

The essential role of MscL in bacterial survival under osmotic stress makes it an attractive target for developing novel antimicrobial strategies, particularly for organisms like B. cereus that show resistance to conventional antibiotics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.