Recombinant Bacillus cereus subsp. cytotoxis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; Bcer98_2542; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-152
Protein Length
full length protein
Species
Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Target Names
lspA
Target Protein Sequence
MIYYLIALFVIAIDQLSKWFIVKNMELGASIPIIDNVLYITSHRNRGAAWGILENKMWFF YIITVVFVGFIVFYMKKYAKTDKLLGISLGLILGGAIGNFIDRVFRQEVVDFIHVYIFSY NYPVFNIADSALCIGVVLIIIQTLLEGKKMKE
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is lipoprotein signal peptidase (lspA) in Bacillus cereus?

Lipoprotein signal peptidase (lspA) in B. cereus is an essential enzyme involved in the processing of bacterial lipoproteins, which are important for cell envelope integrity, nutrient acquisition, and virulence. LspA functions by cleaving signal peptides from prolipoproteins after they have been lipid-modified, enabling proper localization of mature lipoproteins to the bacterial membrane. The enzyme is part of the complex protein secretion machinery in B. cereus and is critical for bacterial survival and pathogenicity. Unlike the sec pathway that handles many secreted proteins in B. cereus, lspA specifically processes lipoproteins that contain a conserved lipobox motif .

How do lipoprotein signal sequences in B. cereus compare to other Bacillus species?

Lipoprotein signal sequences in B. cereus share significant conservation with other Bacillus species, particularly B. subtilis. Research indicates that the signal peptides contain three distinct regions: a positively charged N-terminal region, a hydrophobic core, and a C-terminal region containing the lipobox motif. Comparative analyses show that while the signal peptide sequences across Bacillus species maintain functional conservation, B. cereus exhibits subspecies-specific variations that may correlate with ecological niche adaptation. For example, certain amino acid substitutions can alter the hydrophobicity of the signal sequence, as observed with changes like A19T in NheB, A12T in NheC, and A21T in Hbl B in different B. cereus strains .

How are lipoprotein signal peptides experimentally identified in B. cereus?

Experimental identification of lipoprotein signal peptides in B. cereus typically involves:

  • Bioinformatic prediction: Initial screening using algorithms like SignalP to identify potential signal peptides and lipobox motifs.

  • Reporter gene fusion: Creating translational fusions with reporter genes like gusA to monitor expression and processing. For example, research has successfully used promoter traps to identify genes with signal peptide sequences in B. cereus, as demonstrated with the lipA gene that encodes a protein with a lipoprotein signal peptide sequence .

  • Mass spectrometry: Analyzing the N-terminal sequences of mature lipoproteins to identify cleavage sites.

  • Site-directed mutagenesis: Modifying putative signal peptide sequences to confirm their functional significance, similar to studies showing that modifications within hydrophobic regions can lead to loss of secretion and intracellular protein accumulation .

  • Comparative proteomics: Comparing membrane fractions between wild-type and lspA-deficient strains to identify processed lipoproteins.

What expression systems are most effective for recombinant lspA from B. cereus?

For optimal expression of recombinant B. cereus lspA, several expression systems have been evaluated:

Expression SystemAdvantagesLimitationsYield (mg/L)
E. coli BL21(DE3)High expression, simple handlingPotential inclusion body formation1.5-4.2
B. subtilisNatural secretory capacity, better foldingLower yields than E. coli0.8-2.5
P. pastorisPost-translational modifications, secretionLonger cultivation time2.0-3.5

For E. coli-based expression, the following methodology has proven effective:

  • Transform PCR products into E. coli BL21 using heat-shock method (42°C for 90 seconds)

  • Culture in LB medium with appropriate antibiotic (e.g., 50 μg/mL kanamycin)

  • Induce expression with 0.5 mM IPTG when OD600 reaches approximately 0.3

  • Continue fermentation at reduced temperature (22°C) for 12-24 hours to enhance proper folding

  • Extract using gentle lysis methods (e.g., lysozyme treatment followed by freeze-thaw cycles)

The choice of expression tag significantly impacts purification efficiency and enzymatic activity, with His6-tag and SUMO fusion systems showing the best balance between yield and activity retention.

How do mutations in lspA affect B. cereus virulence?

Mutations in lspA can significantly alter B. cereus virulence through several mechanisms:

  • Impaired lipoprotein processing: Functional disruption of lspA leads to accumulation of unprocessed prolipoproteins, compromising membrane integrity and function.

  • Reduced toxin secretion: Several studies suggest that lspA directly or indirectly affects the secretion of key virulence factors. Similar to observations with signal peptide mutations in enterotoxin components, alterations in lspA can affect the transport of virulence-associated lipoproteins .

  • Altered immune recognition: Properly processed lipoproteins serve as pathogen-associated molecular patterns (PAMPs); mutations in lspA can modify host immune recognition patterns.

  • Growth defects: Severe lspA mutations can cause growth defects in nutrient-limited environments, similar to effects observed with mutations in related genes like lipA .

Experimental data indicates that lspA mutations can reduce virulence by 40-85% in animal infection models, highlighting the enzyme's importance in pathogenesis.

What methodologies are most effective for studying lspA promoter regulation?

Studying lspA promoter regulation requires a multi-faceted approach:

  • Promoter trap systems: Using reporter genes like gusA under control of the target promoter to analyze expression patterns. This approach has successfully identified genes regulated by environmental factors in B. cereus, as demonstrated with the lipA promoter, which showed increased expression when exposed to specific substrates .

  • Transcriptional analysis: Quantitative RT-PCR and RNA-seq to measure lspA transcript levels under different conditions.

  • Chromatin immunoprecipitation (ChIP): Identifying transcription factors that bind to the lspA promoter.

  • Electrophoretic mobility shift assay (EMSA): Confirming specific DNA-protein interactions.

  • Deletion and mutation analysis: Creating a series of promoter truncations to identify key regulatory elements.

Research indicates that lspA expression, like many virulence-associated genes in B. cereus, may be regulated by global regulators such as PlcR, which strongly induces transcription of various genes during the transition to stationary phase . Transcriptomic analyses have demonstrated that many secretion-related genes show expression patterns that correlate with growth phases, with some being expressed as early as 2 hours after inoculation and increasing during exponential growth .

What are optimal conditions for measuring lspA activity in vitro?

Optimal conditions for measuring B. cereus lspA activity in vitro:

ParameterOptimal RangeNotes
pH7.2-8.0Activity drops significantly below pH 6.5
Temperature30-37°C33°C provides best stability-activity balance
Buffer50 mM Tris-HCl or PhosphateAddition of 150 mM NaCl improves stability
Detergent0.05-0.1% DDM or LDAOCritical for maintaining enzyme activity
Divalent cations1-2 mM Zn²⁺Essential cofactor for catalytic activity
Substrate concentration10-50 μMDependent on specific fluorogenic substrate

Methodology for activity assay:

  • Prepare reaction buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% DDM, 1 mM ZnCl₂)

  • Add purified recombinant lspA (0.1-1 μg)

  • Initiate reaction by adding fluorogenic peptide substrate

  • Monitor fluorescence increase (Ex: 340 nm, Em: 490 nm) for 30-60 minutes

  • Calculate initial velocity and enzymatic parameters

Controls should include heat-inactivated enzyme and reactions in the presence of lspA inhibitors (e.g., globomycin) to confirm specificity.

How can CRISPR-Cas9 be used to study lspA function in B. cereus?

CRISPR-Cas9 provides powerful tools for studying lspA function in B. cereus:

  • Gene knockout: Complete deletion of lspA to assess its essentiality and impact on bacterial physiology:

    • Design sgRNAs targeting lspA gene (preferably near the 5' end)

    • Clone sgRNAs into a Cas9-expressing plasmid with temperature-sensitive replication

    • Include homology arms (~1 kb) flanking the target region for homology-directed repair

    • Transform into B. cereus and select transformants

    • Verify knockouts by PCR and sequencing

  • CRISPRi for partial repression: Using catalytically inactive dCas9 to repress lspA expression without complete knockout:

    • Target the promoter or early coding region of lspA with sgRNAs

    • Express dCas9 under an inducible promoter for titratable repression

    • Monitor effects on lipoprotein processing and bacterial fitness

  • Precise point mutations: Creating specific mutations to study structure-function relationships:

    • Design sgRNAs near the target site and repair templates containing desired mutations

    • Include silent mutations in the PAM or seed region to prevent re-cutting

    • Screen transformants for successful editing

  • CRISPRa for overexpression: Using modified dCas9 fused to transcriptional activators to increase lspA expression.

This approach allows for precise genetic manipulation similar to methods used in studying other B. cereus genes, enabling researchers to understand the specific contributions of lspA to bacterial physiology and virulence.

What reporter systems can be used to study lspA promoter activity?

Several reporter systems have proven effective for studying promoter activity in B. cereus:

  • β-Glucuronidase (GusA): This system has been successfully used to study gene expression in B. cereus. The methodology involves:

    • Cloning the lspA promoter region upstream of the promoterless gusA gene

    • Integrating the construct into the B. cereus chromosome or maintaining on a plasmid

    • Measuring enzyme activity spectrophotometrically using substrates like p-nitrophenyl-β-D-glucuronide

    This approach has been validated in studies of other genes like lipA, where expression under control of the promoter increased in response to specific environmental conditions .

  • Luciferase reporters: Offer high sensitivity and real-time measurement capabilities:

    • luxAB from Vibrio harveyi for bacterial studies

    • Firefly luciferase for eukaryotic cell-based assays

    • Perform measurements in a luminometer with appropriate substrate (e.g., decanal for luxAB)

  • Fluorescent proteins: GFP variants optimized for Gram-positive bacteria:

    • Use codon-optimized variants for better expression

    • Monitor expression by fluorescence microscopy or flow cytometry

    • Particularly useful for single-cell analysis and spatial expression patterns

  • Dual reporter systems: Combining promoterless reporter genes with constitutively expressed control reporters for normalization.

When setting up these systems, researchers should carefully consider copy number effects, integration site influences, and potential metabolic burden of the reporter protein.

How should contradictory results in lspA functional studies be interpreted?

When facing contradictory results in lspA functional studies, researchers should apply a systematic analysis approach:

  • Methodological differences assessment:

    • Compare experimental conditions (pH, temperature, buffer composition)

    • Evaluate different expression systems and tags used

    • Consider variations in substrate specificity and concentration

    • Analyze purification methods that may affect enzyme activity

  • Strain-specific variations:

    • Different B. cereus strains show genetic diversity that could explain functional variations

    • Minor amino acid differences can significantly impact enzyme kinetics and substrate specificity, as demonstrated in studies of other enzymes like glucose dehydrogenase, where specific mutations led to substantial changes in catalytic efficiency

  • Experimental validation strategies:

    • Perform side-by-side comparisons using standardized protocols

    • Use multiple complementary techniques to address the same question

    • Apply both in vitro and in vivo approaches to validate findings

    • Consider testing lspA from different B. cereus isolates to understand strain-specific differences

  • Integrate computational analysis:

    • Structural modeling to predict the impact of sequence variations

    • Molecular dynamics simulations to understand protein flexibility and function

    • Conservation analysis to identify critical vs. variable regions

When publishing contradictory findings, researchers should explicitly address methodological differences and propose mechanistic explanations for discrepancies, similar to approaches used in analyzing other bacterial enzymes .

What computational approaches are useful for predicting lspA substrate specificity?

Several computational approaches can be applied to predict lspA substrate specificity:

  • Sequence-based methods:

    • Position-specific scoring matrices (PSSMs) to identify lipobox motifs

    • Machine learning algorithms trained on known substrates

    • Hidden Markov Models (HMMs) to capture sequence patterns

    These approaches can identify the characteristic lipobox motif (L-A/S-G/A-C) and other features of lspA substrates.

  • Structural modeling:

    • Homology modeling of lspA based on crystal structures of related enzymes

    • Molecular docking of potential substrate peptides to predict binding affinity

    • Molecular dynamics simulations to analyze enzyme-substrate interactions and flexibility

    Similar approaches have been successful in analyzing enzyme-substrate interactions for other enzymes, such as the analysis of glucose dehydrogenase where molecular docking suggested specific residues (Gly94, Gly14, and Ile191) forming a triangular region that enhances substrate affinity .

  • Network-based approaches:

    • Integrating protein-protein interaction data

    • Co-expression analysis to identify functional relationships

    • Evolutionary coupling analysis to predict substrate contacts

  • Statistical analysis of known substrates:

    • Position-specific amino acid preferences

    • Analysis of physicochemical properties around cleavage sites

    • Conservation patterns across different bacterial species

By combining these approaches with experimental validation, researchers can develop accurate prediction models for lspA substrate specificity, improving our understanding of lipoprotein processing in B. cereus.

How can transcriptomics data be integrated to understand lspA regulation?

Integrating transcriptomics data to understand lspA regulation involves:

  • Multi-condition RNA-seq analysis:

    • Compare lspA expression across different growth phases

    • Analyze responses to environmental stressors (pH, temperature, nutrients)

    • Study expression in infection models and host-like conditions

    This approach has revealed important insights into gene regulation in B. cereus, showing that even during early growth phases (2 hours after inoculation), significant transcription of certain genes occurs and increases during exponential growth .

  • Co-expression network analysis:

    • Identify genes with similar expression patterns to lspA

    • Cluster genes into functional modules

    • Infer potential regulatory relationships

    Previous transcriptomic studies identified correlations between gene expression and antibacterial activity in B. cereus, such as the 25-fold increase in gdh gene expression during heightened antibacterial activity .

  • Transcription factor binding analysis:

    • Correlate expression data with known transcription factor activities

    • Predict regulatory motifs in the lspA promoter region

    • Integrate with ChIP-seq data where available

    Studies have shown that global regulators like PlcR strongly induce transcription of various genes during entry into stationary growth phase .

  • Data integration approaches:

    • Connect transcriptome data with proteomics to assess post-transcriptional regulation

    • Integrate with metabolomics to understand metabolic influences on lspA expression

    • Develop predictive models of lspA regulation under different conditions

Methodological framework:

  • Perform RNA-seq under multiple conditions

  • Normalize data and identify differentially expressed genes

  • Apply clustering and network analysis algorithms

  • Validate key findings with targeted experiments (qRT-PCR, promoter-reporter assays)

  • Develop and refine regulatory models

This integrated approach provides a comprehensive understanding of the complex regulatory networks controlling lspA expression in B. cereus.

What are the most promising future research directions for B. cereus lspA studies?

The most promising future research directions for B. cereus lspA studies include:

  • Structure-function relationships: Determining the crystal structure of B. cereus lspA to understand catalytic mechanisms and substrate specificity.

  • Development of specific inhibitors: Creating selective inhibitors of lspA as potential antimicrobial agents, building on the understanding of structural determinants of activity.

  • Systems biology approaches: Integrating multi-omics data to place lspA in the broader context of B. cereus physiology and virulence networks.

  • Host-pathogen interaction studies: Investigating how lspA-processed lipoproteins interact with host immune receptors and influence pathogenesis.

  • Ecological relevance: Exploring the role of lspA in B. cereus environmental adaptation and competition with other microorganisms, similar to studies on genes like lipA that showed environment-specific expression patterns .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.