Recombinant Bacillus cereus subsp. cytotoxis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus cereus subsp. cytotoxis NADH-Quinone Oxidoreductase Subunit K (nuoK)

Recombinant Bacillus cereus subsp. cytotoxis NADH-quinone oxidoreductase subunit K (nuoK) is a bioengineered protein derived from the NADH-quinone oxidoreductase complex (Complex I) of Bacillus cereus. This enzyme is a critical component of the bacterial electron transport chain, facilitating the transfer of electrons from NADH to quinones while generating a proton gradient for ATP synthesis . The recombinant form is expressed in Escherichia coli with an N-terminal histidine tag (His-tag) for purification purposes, enabling its use in biochemical, structural, and functional studies .

Protein Architecture

FeatureDetailsSource
Length1–104 amino acids (full-length) or partial constructs
Molecular Weight~12–15 kDa (estimated based on sequence)
TagN-terminal His-tag (6xHis) for affinity chromatography purification
SequenceMNSVPASAYLTLAIILFCIGLFGALTKRNTVIVLVCMELMLNAANLNLVAFSKLGFFPNLTGQIFSLFTMSVAAAEAAVGLAILIALYRNRTTVNIDEMDKLKG
Expression SystemEscherichia coli (inducible expression)

Biological Role

nuoK is a subunit of the NADH-quinone oxidoreductase (NDH-1) complex, which:

  1. Catalyzes Electron Transfer: Facilitates NADH → quinone electron transfer, a pivotal step in aerobic respiration .

  2. Proton Pumping: Contributes to proton translocation across the membrane, driving ATP synthesis .

  3. Pathogenic Context: While Bacillus cereus subsp. cytotoxis is associated with cytotoxicity (e.g., via CytK, Hbl, Nhe toxins), nuoK itself is not directly implicated in virulence but is essential for bacterial energy metabolism .

Biochemical Studies

  • Electron Transport Assays: Used to study NDH-1 complex assembly and quinone-binding dynamics .

  • Structural Analysis: Crystallization and X-ray crystallography to resolve subunit interactions .

Pathogenicity Context

  • Biofilm Formation: While not directly toxic, nuoK may influence B. cereus biofilm formation indirectly via energy metabolism .

  • Toxin Regulation: Although unrelated to enterotoxins (e.g., CytK, Hbl), metabolic stress from NDH-1 dysfunction could modulate virulence factor expression .

Research Gaps and Future Directions

  1. Functional Studies: Limited data exist on nuoK’s role in B. cereus subsp. cytotoxis pathogenicity. Further studies could explore its interaction with other NDH-1 subunits.

  2. Therapeutic Potential: Inhibitors targeting NDH-1 complexes (including nuoK) might serve as novel antimicrobials, though specificity remains a challenge .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will strive to fulfill your requests.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Important: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Bcer98_3812; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Target Names
nuoK
Target Protein Sequence
MNSVPASAYLTLAIILFCIGLFGALTKRNTVIVLVCMELMLNAANLNLVAFSKLGFFPNL TGQIFSLFTMSVAAAEAAVGLAILIALYRNRTTVNIDEMDKLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this specific organism, the immediate electron acceptor for the enzyme is believed to be a menaquinone. This process couples the redox reaction to proton translocation, resulting in the movement of four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. Consequently, it conserves redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase and what role does the nuoK subunit play in Bacillus cereus subsp. cytotoxis?

NADH-quinone oxidoreductase, also known as Complex I, catalyzes the first step of oxidative phosphorylation by oxidizing NADH through ubiquinone. This enzyme complex couples this oxidoreduction reaction with active proton transport across the bacterial cytoplasmic membrane . In bacterial systems like B. cereus, this respiratory complex is critical for energy production.

The nuoK subunit is one of the membrane-embedded components of Complex I that contributes to the proton-pumping mechanism. Research on similar respiratory complexes suggests that nuoK forms part of the interface between the hydrophilic and hydrophobic domains of Complex I, potentially participating in the binding site for electron transport inhibitors like piericidin and rotenone . This positioning is crucial for the energy conversion process that drives ATP synthesis.

In B. cereus subsp. cytotoxis specifically, nuoK likely functions within the context of this organism's unique metabolic and pathogenic properties. While the exact structure-function relationship remains an active area of investigation, the nuoK subunit is believed to form part of the proton translocation pathway within the membrane domain of the complex.

How does Bacillus cereus subsp. cytotoxis differ from other members of the B. cereus group?

Bacillus cereus subsp. cytotoxis is distinguished primarily by its production of cytotoxin K (CytK), a 34 kDa protein that demonstrates high cytotoxicity along with necrotic and hemolytic properties . Unlike many other B. cereus strains that produce multiple enterotoxins, B. cereus subsp. cytotoxis strains may lack production of other known B. cereus enterotoxins such as the non-hemolytic enterotoxin (Nhe) and hemolysin BL (Hbl) .

The cytotoxin K protein shows significant sequence similarity to other bacterial toxins including Staphylococcus aureus leucocidins, gamma-hemolysin, alpha-hemolysin, Clostridium perfringens beta-toxin, and B. cereus hemolysin II . These toxins all belong to a family of beta-barrel channel-forming toxins, which create pores in cell membranes leading to cell lysis. This relationship suggests that B. cereus subsp. cytotoxis causes a disease similar to, though potentially less severe than, the necrotic enteritis caused by C. perfringens type C .

From a regulatory perspective, the cytK gene in B. cereus subsp. cytotoxis includes a recognition site for PlcR in its promoter region . PlcR is a pleiotropic regulator that controls the transcription of various toxin genes in B. cereus, including the enterotoxins HBL and Nhe .

What expression systems are most effective for producing recombinant nuoK from B. cereus subsp. cytotoxis?

Successful expression of membrane proteins like nuoK requires specialized approaches. Based on methodologies for similar proteins, the following expression systems offer effective options:

Bacterial Expression Systems:

  • E. coli C41(DE3) and C43(DE3) strains: These "Walker strains" contain mutations that allow better tolerance of toxic membrane proteins

  • Lemo21(DE3): Offers tunable expression through rhamnose-controlled lysozyme production

  • Expression vectors containing:

    • Tightly controlled inducible promoters (T7 with lac operator)

    • Fusion tags that enhance membrane insertion (Mistic, YidC)

    • Solubility enhancers (MBP, SUMO) with cleavable linkers

Optimization Parameters:

  • Induction at low temperature (16-20°C) to slow protein production and improve folding

  • Reduced inducer concentrations (0.1-0.2 mM IPTG) to prevent overwhelming the membrane insertion machinery

  • Growth media supplementation with specific lipids to facilitate membrane protein integration

  • Co-expression with chaperones (GroEL/ES, DnaK/J) to assist proper folding

Alternative Expression Systems:

  • Cell-free expression systems with supplied lipids or detergents

  • Bacillus subtilis expression for homologous expression environment

  • Insect cell/baculovirus systems for complex membrane proteins requiring eukaryotic folding machinery

When expressing nuoK specifically, it's crucial to verify proper membrane integration and folding through activity assays and structural characterization methods before proceeding to functional studies.

What purification strategies yield functional recombinant nuoK protein for biochemical studies?

Purifying functional nuoK presents significant challenges due to its hydrophobic nature and membrane localization. An effective purification strategy typically includes the following steps:

Membrane Extraction:

  • Gentle cell disruption by sonication or French press

  • Differential centrifugation to isolate membrane fractions

  • Selective solubilization using mild detergents (n-dodecyl-β-D-maltoside or lauryl maltose neopentyl glycol)

Chromatographic Purification:

  • Immobilized metal affinity chromatography (IMAC) using His-tagged nuoK

  • Addition of lipids (0.1-0.5 mg/ml) during purification to maintain stability

  • Inclusion of glycerol (10-20%) and reducing agents to prevent aggregation

  • Size exclusion chromatography to remove aggregates and verify oligomeric state

Alternative Solubilization Approaches:

  • Styrene maleic acid lipid particles (SMALPs) for detergent-free extraction

  • Amphipols for stabilization after initial detergent solubilization

  • Nanodiscs for reconstitution in a native-like lipid bilayer environment

Quality Control Assessments:

  • Circular dichroism to verify secondary structure integrity

  • Thermal shift assays to evaluate stability

  • Activity assays to confirm functional state

  • Blue native-PAGE to analyze complex assembly

For studies requiring incorporation into model membranes, additional proteoliposome reconstitution steps are necessary, carefully controlling protein-to-lipid ratios and using controlled detergent removal methods (dialysis or Bio-Beads).

How can researchers assess the functional activity of recombinant nuoK within the NADH-quinone oxidoreductase complex?

Reconstitution Approaches:

  • Co-expression with other essential Complex I subunits

  • Reconstitution of purified nuoK with native Complex I lacking nuoK

  • Integration into proteoliposomes with defined orientation

NADH Oxidation Measurements:

  • Spectrophotometric monitoring of NADH oxidation (340 nm)

  • Oxygen consumption using Clark-type electrodes

  • Reduction of artificial electron acceptors (ferricyanide, ubiquinone analogs)

Proton Pumping Assays:

  • pH-sensitive fluorescent dyes (ACMA, pyranine) in proteoliposomes

  • Ion-selective electrodes to measure pH changes

  • Membrane potential measurements using voltage-sensitive probes

Inhibitor Binding Studies:

  • Competitive binding assays with known Complex I inhibitors like piericidin and rotenone

  • Isothermal titration calorimetry to determine binding parameters

  • Photolabeling with reactive inhibitor analogs to map binding sites

Mutagenesis Approaches:

  • Site-directed mutagenesis of conserved residues

  • Activity comparison between wild-type and mutant proteins

  • Complementation of nuoK-deficient strains with mutant variants

These functional assays should be performed with appropriate controls, including samples lacking nuoK, heat-inactivated samples, and inhibitor-treated samples to establish specificity of the measured activities.

What methods are appropriate for studying the structural characteristics of nuoK and its interactions with other Complex I subunits?

Understanding nuoK's structure and interactions requires specialized approaches for membrane proteins:

Structural Characterization:

  • Cryo-electron microscopy of the intact Complex I

  • X-ray crystallography of stabilized nuoK (often requiring fusion partners or antibody fragments)

  • NMR spectroscopy of selectively labeled nuoK in detergent micelles or nanodiscs

  • Hydrogen-deuterium exchange mass spectrometry to probe solvent-accessible regions

Protein-Protein Interaction Analysis:

  • Cross-linking mass spectrometry to map interaction interfaces

  • Blue native PAGE to assess complex assembly

  • Co-immunoprecipitation with tagged versions of interacting partners

  • FRET-based approaches using fluorescently labeled subunits

Computational Methods:

  • Homology modeling based on related structures

  • Molecular dynamics simulations in membrane environments

  • Coevolution analysis to predict interacting residues

  • Bioinformatic identification of conserved functional motifs

Topological Mapping:

  • Cysteine scanning mutagenesis with selective labeling

  • Proteolytic digestion patterns in different membrane environments

  • Epitope insertion and accessibility mapping

  • Fluorescent protein fusions to determine orientation

These methods can reveal how nuoK is positioned within the complex, which residues are involved in proton translocation, and how conformational changes during catalysis might propagate through the protein structure.

How might mutations in nuoK affect the bioenergetics and virulence of B. cereus subsp. cytotoxis?

The relationship between nuoK function, cellular bioenergetics, and bacterial virulence represents an important research frontier:

Bioenergetic Consequences:

  • Reduced proton pumping efficiency affecting ATP synthesis

  • Altered membrane potential influencing various cellular processes

  • Metabolic rewiring to compensate for deficiencies in NADH oxidation

  • Changes in redox balance affecting numerous cellular pathways

Potential Virulence Impacts:

  • Disrupted energy production potentially affecting toxin synthesis and secretion

  • Altered membrane potential influencing protein secretion systems

  • Changes in cellular redox state affecting regulatory systems controlling virulence gene expression

  • Possible connections to PlcR regulatory pathways that control toxin production

Experimental Approaches:

  • Creation of nuoK point mutations or deletions in B. cereus subsp. cytotoxis

  • Measurement of growth rates under different metabolic conditions

  • Quantification of toxin production in wild-type versus mutant strains

  • Transcriptomic and proteomic analysis to identify affected pathways

  • Cell culture and animal models to assess virulence changes

Research Significance:

  • Establishing connections between energy metabolism and pathogenicity

  • Identifying potential targets for antimicrobial development

  • Understanding bacterial adaptation mechanisms during infection

  • Elucidating environmental condition sensing linked to virulence

This research direction could reveal whether respiratory chain components like nuoK could serve as targets for novel therapeutic approaches that simultaneously compromise bacterial viability and virulence.

What is the relationship between respiratory chain components like nuoK and regulation of toxin production in B. cereus?

The potential regulatory connections between respiratory metabolism and virulence factor production in B. cereus represent an emerging area of research:

Regulatory Mechanisms:

  • Metabolic sensing affecting transcriptional regulators of toxin genes

  • Membrane potential influencing protein secretion systems

  • Redox-responsive regulatory proteins possibly controlling both respiration and virulence

  • PlcR, which regulates expression of various toxins including CytK, may respond to metabolic signals

Research Evidence:

  • The promoter region of cytK contains recognition sites for PlcR, a major virulence regulator in B. cereus

  • Energy metabolism defects can trigger stress responses that alter virulence gene expression

  • Proton motive force is crucial for protein secretion, including toxin export

  • Altered NADH/NAD+ ratios potentially affecting global gene regulation

Methodological Approaches:

  • Reporter gene constructs linking metabolic state to toxin promoter activity

  • Transcriptomics under respiratory inhibition conditions

  • Protein secretion analysis after manipulation of nuoK function

  • Measurement of intracellular ATP levels and membrane potential correlated with toxin production

Potential Applications:

  • Development of respiratory inhibitors as anti-virulence compounds

  • Identification of metabolic signals controlling toxin production

  • Design of intervention strategies targeting both respiration and virulence

  • Understanding environmental triggers for toxin production

This research area connects basic bacterial physiology to pathogenesis mechanisms, potentially leading to new strategies for preventing or treating B. cereus infections through metabolic modulation.

How can structure-function studies of nuoK contribute to the development of specific inhibitors against B. cereus?

Structure-function studies of nuoK offer promising avenues for targeted inhibitor development:

Target Validation Approaches:

  • Essentiality assessment under different growth conditions

  • Evaluation of conservation across B. cereus strains

  • Determination of structural differences compared to human homologs

  • Identification of functionally critical residues unique to bacterial nuoK

Inhibitor Design Strategies:

  • Structure-based virtual screening against identified binding pockets

  • Fragment-based drug discovery approaches

  • Repurposing known respiratory inhibitors with optimization for selectivity

  • Design of peptidomimetics targeting protein-protein interactions within Complex I

Screening Methods:

  • High-throughput biochemical assays using purified recombinant nuoK

  • Phenotypic screens with readouts for respiratory function

  • Thermal shift assays to identify stabilizing compounds

  • Surface plasmon resonance for direct binding measurements

Evaluation Criteria:

  • Selectivity for bacterial versus human respiratory complexes

  • Effect on growth under aerobic versus anaerobic conditions

  • Impact on toxin production and secretion

  • Development of resistance through adaptive mutations

Translational Potential:

  • Novel antimicrobials with distinct mechanisms from existing antibiotics

  • Combined targeting of bacterial viability and virulence

  • Potential for narrow-spectrum activity against B. cereus group

  • Adjuvant therapy to enhance conventional antibiotic efficacy

This research direction leverages fundamental understanding of nuoK structure and function toward practical applications in antimicrobial development, addressing the urgent need for new approaches against bacterial pathogens.

What are the key challenges in expressing and characterizing membrane proteins like nuoK, and how can they be addressed?

Membrane proteins like nuoK present specific challenges that require specialized approaches:

Expression Challenges:

  • Toxicity to expression hosts

  • Protein misfolding and aggregation

  • Low yields of correctly folded protein

  • Improper membrane insertion

Technical Solutions:

  • Use of specialized expression strains (C41/C43, Lemo21)

  • Tightly controlled expression with reduced inducer concentrations

  • Lower expression temperatures (16-20°C)

  • Co-expression with folding chaperones

  • Fusion to solubility/folding enhancers (MBP, SUMO)

Purification Challenges:

  • Maintaining stability during extraction

  • Preventing aggregation

  • Loss of associated lipids

  • Difficulties in assessing purity and homogeneity

Technical Solutions:

  • Systematic screening of detergents and stabilizing additives

  • Addition of specific lipids during purification

  • Use of amphipols, nanodiscs, or SMALPs for stabilization

  • Thermostability assays to optimize buffer conditions

  • Blue native PAGE to assess complex integrity

Functional Characterization Challenges:

  • Separating nuoK function from other complex components

  • Establishing suitable activity assays

  • Maintaining native conformation and interactions

  • Recreating physiological membrane environment

Technical Solutions:

  • Reconstitution into proteoliposomes with defined composition

  • Development of subunit-specific assays through strategic mutations

  • Complementation studies in knockout backgrounds

  • Advanced biophysical techniques (EPR, FRET, cryo-EM)

Structural Analysis Challenges:

  • Conformational heterogeneity

  • Difficulties in obtaining crystals

  • Limited resolution in membrane environments

Technical Solutions:

  • Single-particle cryo-EM for entire complex

  • X-ray crystallography with stabilizing antibody fragments

  • NMR of specifically labeled domains

  • Computational modeling informed by experimental constraints

These methodological solutions represent current best practices in membrane protein biochemistry and structural biology, allowing researchers to overcome the inherent challenges of working with proteins like nuoK.

How can researchers effectively study the proton translocation function of nuoK in controlled systems?

Studying the specific proton translocation function of nuoK requires sophisticated experimental designs:

Reconstituted Systems:

  • Proteoliposomes containing purified nuoK or complete Complex I

  • Defined lipid composition mimicking bacterial membranes

  • Controlled protein orientation through reconstitution methods

  • Incorporation of pH-sensitive probes inside vesicles

Measurement Techniques:

  • Fluorescence quenching of pH-sensitive dyes (ACMA, pyranine)

  • Stopped-flow spectroscopy for rapid kinetics

  • Ion-selective electrodes for continuous pH monitoring

  • Patch-clamp electrophysiology of reconstituted proteins

Experimental Design Considerations:

  • Generation of proton gradient using light-activated proton pumps as controls

  • Comparison of wild-type versus mutant nuoK variants

  • Use of specific inhibitors to block different steps in proton movement

  • Manipulation of membrane potential to assess voltage dependence

Advanced Approaches:

  • Site-directed spin labeling and EPR spectroscopy to track conformational changes

  • Tryptophan fluorescence to monitor local environmental changes

  • Hydrogen-deuterium exchange to identify dynamic regions

  • Time-resolved structural methods to capture transient states

Data Analysis Methods:

  • Kinetic modeling of proton translocation rates

  • Determination of stoichiometry between electron transfer and proton pumping

  • Thermodynamic analysis of proton movement against different gradients

  • Correlation of structural changes with functional outcomes

These methodologies allow researchers to isolate and characterize the specific contribution of nuoK to the proton translocation process, providing mechanistic insights that could inform inhibitor design and our understanding of respiratory complex function.

How can systems biology approaches enhance our understanding of nuoK's role in B. cereus metabolism and pathogenicity?

Systems biology offers powerful frameworks for understanding nuoK function in its broader cellular context:

Multi-omics Integration:

  • Transcriptomics to identify gene expression changes in nuoK mutants

  • Proteomics to map protein-protein interactions and abundance changes

  • Metabolomics to detect metabolic pathway alterations

  • Fluxomics to quantify changes in metabolic rates

Network Analysis Approaches:

  • Construction of protein-protein interaction networks centered on respiratory complexes

  • Metabolic flux balance analysis incorporating nuoK function

  • Regulatory network modeling connecting respiratory state to virulence

  • Identification of compensatory pathways activated upon nuoK disruption

Computational Modeling:

  • Whole-cell models incorporating respiratory chain function

  • Dynamic simulations of energy metabolism under different conditions

  • Machine learning approaches to identify patterns in multi-omics data

  • Constraint-based modeling to predict growth phenotypes

Experimental Validation:

  • CRISPR interference for temporal control of nuoK expression

  • Biosensors to monitor cellular energetics in real-time

  • High-throughput phenotyping under diverse environmental conditions

  • Single-cell analyses to capture population heterogeneity

Translational Applications:

  • Identification of synthetic lethal interactions as drug targets

  • Prediction of metabolic vulnerabilities specific to pathogenic states

  • Understanding bacterial adaptation to host environments

  • Development of diagnostic biomarkers based on metabolic signatures

This systems approach provides a comprehensive view of how nuoK contributes to cellular function beyond its immediate role in NADH oxidation, revealing emergent properties that may not be apparent from reductionist studies.

What novel biotechnological applications might emerge from research on B. cereus nuoK and related respiratory chain components?

Research on nuoK and related respiratory components may lead to innovative biotechnological applications:

Biosensor Development:

  • Engineered B. cereus strains with nuoK-linked reporters for environmental toxin detection

  • Incorporation of purified Complex I components into electrochemical biosensors

  • Development of high-throughput screening platforms for respiratory inhibitors

  • Cell-based assays for metabolic disruption

Bioenergy Applications:

  • Engineering optimized respiratory chains for enhanced biofuel production

  • Development of bacterial fuel cells utilizing modified respiratory complexes

  • Improved understanding of electron transfer for synthetic biology applications

  • Creation of hybrid energy-generating systems combining biological and chemical components

Protein Engineering:

  • Designed proton pumps with modified specificity or efficiency

  • Creation of minimal respiratory complexes with desired properties

  • Development of switchable energy-generating modules

  • Engineering of membrane proteins with enhanced stability for biotechnological applications

Therapeutic Platforms:

  • Targeted delivery systems based on respiratory chain inhibition

  • Development of narrow-spectrum antimicrobials against specific pathogens

  • Engineering of probiotics with modified respiratory capabilities

  • Creation of bacterial chassis for therapeutic protein production

Environmental Applications:

  • Bioremediation systems utilizing engineered respiratory chains

  • Biosensors for environmental monitoring of respiratory toxins

  • Development of bacterial strains with modified resistance to environmental stressors

  • Waste-to-energy microbial systems with optimized respiratory efficiency

These applications leverage fundamental understanding of respiratory chain biology toward practical solutions in biotechnology, environmental science, and human health.

What emerging technologies might advance our understanding of nuoK and other membrane-bound respiratory complex components?

Several cutting-edge technologies are poised to transform research on membrane proteins like nuoK:

Structural Biology Advances:

  • Cryo-electron tomography for in situ visualization in native membranes

  • Micro-electron diffraction for structure determination from tiny crystals

  • Integrative structural biology combining multiple data types

  • Time-resolved structural methods capturing conformational dynamics

Single-Molecule Techniques:

  • High-speed atomic force microscopy for direct observation of conformational changes

  • Single-molecule FRET to track distance changes during function

  • Nanodiscs with single protein complexes for controlled studies

  • Optical tweezers for measuring forces involved in conformational changes

Genetic Engineering Tools:

  • CRISPR-Cas systems for precise genome editing of B. cereus

  • Inducible degron systems for rapid protein depletion

  • Optogenetic control of membrane potential

  • Expanded genetic code incorporation for site-specific protein labeling

Artificial Intelligence Applications:

  • Improved protein structure prediction through deep learning

  • Automated image analysis for structural studies

  • Predictive modeling of protein-protein interactions

  • Design of protein variants with desired properties

Microfluidic and Lab-on-a-Chip Approaches:

  • Single-cell analysis of respiratory function

  • High-throughput screening platforms for inhibitor discovery

  • Gradient generation systems mimicking infection environments

  • Organ-on-chip models for host-pathogen interaction studies

These emerging technologies promise to overcome current limitations in studying complex membrane proteins, providing unprecedented insights into structure, dynamics, and function that could lead to breakthroughs in our understanding of bacterial bioenergetics and pathogenesis.

How might cross-disciplinary approaches enhance research on bacterial respiratory complexes like those containing nuoK?

Cross-disciplinary collaboration offers powerful approaches to complex research questions:

Biophysics-Biochemistry Integration:

  • Combining structural studies with functional assays

  • Correlating energy calculations with experimental measurements

  • Development of spectroscopic tools specific for respiratory complexes

  • Application of nanoscale techniques to biological systems

Synthetic Biology-Systems Biology Fusion:

  • Construction of minimal respiratory systems with defined components

  • Design of reporter systems for monitoring respiratory chain function

  • Creation of tunable gene circuits linked to energy metabolism

  • Development of whole-cell models incorporating respiratory function

Clinical Microbiology-Molecular Biology Collaboration:

  • Translation of molecular findings to clinical isolate studies

  • Correlation of respiratory chain variants with virulence in clinical settings

  • Development of diagnostic tools based on respiratory function

  • Testing of respiratory inhibitors in clinically relevant models

Materials Science-Biochemistry Partnerships:

  • Development of biomimetic membranes for protein reconstitution

  • Creation of nanomaterials for stabilizing membrane proteins

  • Design of bioelectronic interfaces with respiratory complexes

  • Engineering of structured environments mimicking bacterial membranes

Computational-Experimental Biology Integration:

  • Molecular dynamics simulations guiding experimental design

  • Machine learning analysis of complex datasets

  • In silico prediction of inhibitor binding validated by experiments

  • Modeling of evolutionary trajectories informed by sequence analysis

These interdisciplinary approaches can overcome traditional barriers between fields, bringing diverse expertise and methodologies to bear on the complex challenges of understanding nuoK function in bacterial physiology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.