Recombinant Bacillus cereus subsp. cytotoxis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus cereus subsp. cytotoxis Prolipoprotein Diacylglyceryl Transferase (Lgt)

Recombinant Bacillus cereus subsp. cytotoxis Prolipoprotein diacylglyceryl transferase (Lgt) is a recombinant form of the enzyme responsible for the first step in bacterial lipoprotein biosynthesis. This enzyme catalyzes the transfer of a diacylglyceryl group from phosphatidylglycerol to the conserved +1 cysteine residue of prolipoproteins, enabling their anchoring to bacterial membranes . In Bacillus cereus subsp. cytotoxis, a subspecies associated with cytotoxic activity, Lgt plays a critical role in membrane integrity and pathogenicity. Recombinant Lgt proteins are engineered for structural and functional studies, often expressed in E. coli with affinity tags (e.g., His-tag) for purification .

Applications in Biomedical Research

5.1 Diagnostic and Therapeutic Tools
Recombinant Lgt is utilized in:

  • ELISA kits: For detecting anti-Lgt antibodies in immunological studies .

  • Structural biology: Crystallization studies to elucidate catalytic mechanisms .

5.2 Comparative Analysis
A comparison of Lgt functionality across bacterial species is summarized below:

SpeciesLgt EssentialityKey PhenotypesReferences
E. coliEssentialGrowth inhibition; accumulation of unmodified lipoproteins
B. subtilisNon-essentialReduced protein secretion; viable mutants
B. anthracisCrucial for virulenceAttenuated spore germination; reduced macrophage TNF-α response

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preference in the order remarks, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please notify us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are discouraged. For short-term storage, working aliquots can be kept at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
lgt; Bcer98_3705; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Target Names
lgt
Target Protein Sequence
MLLGSVPQLDRVAIHLGPFPVYWYGIIIGTGVLLGLWLATREGERLGIPKDTFVDLVLFA VPIAIICARAYYVAFEWEYYMQNPIQIINTRQGGLAIHGGLIGAVMTGIIYAKVKRISFW KLADIAAPSILLGQAIGRWGNFMNQEAHGGEVTRQFLEGLHLPDFIVNQMYIDGVYYHPT FLYESLWSFAGVILLLLLRKANLRRGELFFTYLIWYSIGRFFVEELRTDSLMLGPLRIAQ VMSIGLIVISIIFIIVRRKTGQADKRYLEK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of prolipoprotein diacylglyceryl transferase (lgt) in Bacillus species?

Prolipoprotein diacylglyceryl transferase (lgt) is a critical enzyme that catalyzes the first step in bacterial lipoprotein biosynthesis by attaching a diacylglyceryl moiety to the conserved cysteine residue in the lipobox motif of prolipoproteins. In Bacillus species, lgt functions by transferring the lipid anchor to prolipoproteins, which is essential for proper lipoprotein localization and function . Research with B. anthracis has demonstrated that lgt-mediated lipoprotein biosynthesis affects surface hydrophobicity, with lgt mutants showing decreased surface hydrophobicity compared to wild-type strains . This modification is crucial for maintaining bacterial membrane integrity and facilitating interactions with the environment.

How does lgt contribute to bacterial spore germination?

Lgt plays a significant role in efficient spore germination in Bacillus species. Studies with B. anthracis have shown that spores derived from lgt mutant strains germinate inefficiently both in vitro and in vivo (mouse skin model) . This suggests that properly processed lipoproteins are required for optimal spore germination processes. The specific mechanisms may involve:

  • Proper assembly of germination receptors in the spore membrane

  • Facilitation of signal transduction during germination

  • Interaction with host factors that trigger germination in vivo

The germination deficiency observed in lgt mutants has significant implications for pathogenesis, as inefficient germination directly correlates with reduced virulence in infection models .

What experimental evidence supports the role of lgt in Bacillus virulence?

In B. anthracis infection models, lgt has been demonstrated to be essential for full virulence. Specifically:

  • Spores from lgt mutant strains show markedly attenuated virulence in murine subcutaneous infection models

  • The attenuation appears specifically related to spore germination efficiency rather than vegetative cell function

  • Vegetative cells of lgt mutants demonstrate virulence comparable to wild-type strains

This differential effect on spore versus vegetative cell virulence provides important insights into stage-specific requirements for lipoproteins during the Bacillus infection cycle.

What techniques can be used to generate and confirm lgt knockout mutants in Bacillus species?

Generation and validation of lgt knockout mutants requires a methodical approach:

Generation methods:

  • Allelic replacement using homologous recombination

  • CRISPR-Cas9 genome editing

  • Transposon mutagenesis with targeted screening

Confirmation techniques:

  • PCR verification of gene deletion

  • Whole-genome sequencing to ensure clean deletion

  • 14C-palmitate labeling to confirm absence of lipoproteins

  • Hydrocarbon partitioning assays to demonstrate altered surface hydrophobicity

  • Western blotting with anti-lipoprotein antibodies

The combination of genetic and biochemical confirmation ensures that the observed phenotypes are directly attributable to lgt deletion rather than polar effects or secondary mutations.

How can researchers effectively express and purify recombinant B. cereus lgt for in vitro studies?

Recombinant expression of B. cereus lgt presents several challenges due to its membrane-associated nature. An effective expression and purification strategy involves:

  • Vector selection: Use of expression vectors with strong, inducible promoters (T7, tac) and appropriate fusion tags (His6, MBP, GST)

  • Expression systems:

    • E. coli-based systems (BL21(DE3), C41(DE3)) for high yield

    • Bacillus-based systems for native-like processing

    • Cell-free expression systems for difficult-to-express constructs

  • Optimization parameters:

    ParameterTypical RangeConsiderations
    Induction temperature16-30°CLower temperatures for improved folding
    Inducer concentration0.1-1.0 mM IPTGStrain and construct dependent
    Expression time4-24 hoursBalance between yield and degradation
    Detergent selectionDDM, LDAO, OGCritical for membrane protein solubilization
  • Purification strategy:

    • Membrane fraction isolation

    • Detergent solubilization

    • Affinity chromatography

    • Size exclusion chromatography

  • Activity validation:

    • In vitro lipid transfer assays

    • Mass spectrometry confirmation of substrate modification

This systematic approach maximizes the likelihood of obtaining functional recombinant lgt protein suitable for downstream applications.

What in vitro assays can measure lgt enzymatic activity?

Several complementary assays can be employed to assess lgt enzymatic activity:

  • Radiolabeled lipid incorporation assay:

    • Incubation of purified lgt with synthetic prolipoprotein substrates and [14C]-labeled diacylglycerol

    • Detection of labeled lipoproteins by SDS-PAGE and autoradiography

    • Quantification by scintillation counting

  • Fluorescence-based assays:

    • FRET-based detection of enzyme-substrate interactions

    • Environment-sensitive fluorescent probes that change emission properties upon lipid transfer

  • Mass spectrometry-based assays:

    • Direct detection of modified versus unmodified peptide substrates

    • Precise mass shift determination corresponding to diacylglycerol addition

  • Colorimetric coupled enzyme assays:

    • Linking lgt activity to secondary reactions that produce colorimetric readouts

    • Plate reader compatibility for higher throughput screening

These assays enable quantitative assessment of enzyme kinetics, substrate specificity, and inhibitor screening.

How does lgt function differ between B. cereus and other pathogenic Bacillus species?

Comparative analysis reveals both conservation and variation in lgt function across Bacillus species:

  • Sequence homology:
    B. cereus lgt shares significant homology with B. anthracis (~95% identity) but shows greater divergence from B. subtilis (~70% identity). These sequence differences may reflect adaptation to different ecological niches.

  • Substrate specificity:
    The lipoprotein profile varies significantly between species. B. cereus expresses several unique lipoproteins not found in B. anthracis, particularly those involved in environmental persistence and food contamination pathways .

  • Virulence contribution:
    While lgt deletion in B. anthracis primarily affects spore germination , the pathogenicity mechanisms in B. cereus may involve additional factors. B. cereus is known for its diverse toxin repertoire, including the nonhemolytic enterotoxin (Nhe) complex and sphingomyelinase, which may interact with lgt-processed lipoproteins .

  • Regulation patterns:
    B. cereus shows distinct regulatory patterns for lgt expression based on environmental conditions, particularly in response to gastrointestinal stresses .

These differences highlight the importance of species-specific investigation rather than extrapolating findings across the Bacillus genus.

What is the relationship between lgt function and formation of anthrax-like cutaneous lesions by B. cereus?

Recent investigations of B. cereus strains causing anthrax-like cutaneous lesions provide insights into potential connections with lgt function:

  • Cutaneous B. cereus infections can present with anthrax-like lesions, characterized by rapidly spreading cellulitis and sometimes gas gangrene-like manifestations .

  • Phylogenetic analysis clusters most pathogenic B. cereus strains into clade I, which contains strains with distinct virulence factor profiles .

  • The synergistic interaction between toxins like nonhemolytic enterotoxin (Nhe) and sphingomyelinase appears critical for cutaneous lesion development .

  • Since proper localization of many virulence factors depends on lgt-mediated lipoprotein processing, it likely plays a role in the assembly of the secretion machinery for these toxins.

  • Functional lipoproteins may facilitate B. cereus adhesion to skin structures, enhancing local toxin delivery and lesion formation.

Further research specifically examining lgt function in clinical isolates from cutaneous infections would help clarify these relationships.

How do environmental factors affect lgt expression and function during B. cereus spore germination?

Environmental factors significantly modulate lgt expression and function during the B. cereus life cycle:

  • Gastrointestinal conditions:

    • Acidic pH, bile salts, and digestive enzymes encountered during gastrointestinal passage influence lgt expression

    • In vitro simulation experiments demonstrate that B. cereus spores can survive and germinate under these conditions

    • The competing intestinal microbiota suppresses vegetative outgrowth following germination

  • Temperature-dependent regulation:

    • Psychrotrophic and mesophilic B. cereus strains show different lgt expression patterns at various temperatures

    • This adaptation allows strain-specific optimization of lipoprotein processing across environmental niches

  • Oxygen availability:

    • Aerobic versus anaerobic conditions alter lgt expression profiles

    • This affects spore germination efficiency in different host tissues

  • Nutrient availability:

    • Specific nutrient signals trigger differential lgt expression

    • This mechanism allows selective germination in favorable growth environments

Understanding these environmental interactions is crucial for predicting B. cereus behavior in diverse settings from food matrices to human tissues.

What structural features of lgt are essential for enzymatic function, and how might they be targeted therapeutically?

Analysis of lgt structure reveals several features crucial for function that represent potential therapeutic targets:

  • Catalytic site architecture:

    • The catalytic site contains conserved histidine and arginine residues essential for substrate binding

    • These residues coordinate diacylglycerol positioning for nucleophilic attack by the substrate cysteine

  • Membrane-embedded regions:

    • Hydrophobic transmembrane domains anchor the enzyme in the cytoplasmic membrane

    • These domains create a hydrophobic environment necessary for lipid substrate access

  • Substrate recognition elements:

    • The lipobox recognition motif specifically binds the conserved sequence in prolipoproteins

    • This region shows some species-specific variations that could be exploited for selective targeting

  • Potential therapeutic strategies:

    ApproachTarget SiteAdvantagesChallenges
    Competitive inhibitorsCatalytic siteDirect blockade of enzymatic functionAchieving selectivity vs. host enzymes
    Allosteric modulatorsRegulatory domainsPotential for higher specificityIdentifying effective binding sites
    Membrane disruptorsTransmembrane regionsNovel mechanism of actionAvoiding host membrane toxicity
    Covalent modifiersCatalytic cysteineLong-lasting inhibitionControlling reactivity
  • Rational design considerations:

    • Species-specific differences in the substrate binding pocket could enable selective targeting of B. cereus lgt

    • Computational modeling suggests several druggable pockets distinct from human enzymes

Given that lgt deletion attenuates virulence while not being immediately lethal to the bacterium , it represents a promising anti-virulence target that may impose less selective pressure than traditional bactericidal agents.

How can understanding lgt function inform the development of new prevention strategies for B. cereus infection?

Leveraging lgt research offers several promising avenues for B. cereus infection prevention:

  • Spore germination inhibitors:

    • Since lgt affects spore germination , compounds targeting this pathway could prevent the initial establishment of infection

    • These germination inhibitors would be particularly valuable for preventing cutaneous anthrax-like lesions in healthcare settings

  • Environmental decontamination strategies:

    • Knowledge of lipoprotein biology enables development of more effective cleaning protocols

    • Targeted surfactants that disrupt lipoprotein anchoring could enhance spore removal from surfaces

  • Vaccine development:

    • Attenuated lgt mutant strains could serve as live vaccine candidates

    • Recombinant lipoproteins processed by lgt represent promising subunit vaccine antigens

  • Diagnostic applications:

    • Detection of specific lgt-processed lipoproteins could enable rapid identification of pathogenic B. cereus strains

    • This would allow earlier intervention in healthcare settings, where rapid identification is critical

These approaches could significantly reduce the incidence of B. cereus infections, particularly in vulnerable populations like newborns who are susceptible to cutaneous anthrax-like lesions .

What are the methodological challenges in studying lgt contribution to B. cereus pathogenesis in animal models?

Investigating lgt's role in B. cereus pathogenesis presents several methodological challenges:

  • Model selection constraints:

    • Different animal models variably recapitulate human infection aspects

    • Murine models effectively demonstrate spore germination effects but may not fully replicate human cutaneous presentations

    • Porcine skin models better reflect human cutaneous infections but are more resource-intensive

  • Strain variation considerations:

    • The high genetic diversity among B. cereus isolates complicates interpretation

    • MLST analysis reveals numerous sequence types with varying virulence potential

    • This necessitates careful strain selection and comprehensive genomic characterization

  • Route of administration optimization:

    • Subcutaneous, intradermal, oral, and inhalational routes produce different pathologies

    • The appropriate route depends on the specific disease manifestation being studied

    • For cutaneous lesion studies, superficial versus deep dermal inoculation produces different pathologies

  • Distinguishing direct and indirect effects:

    • Separating lgt's direct impact on virulence from secondary effects on general bacterial fitness

    • Complementation studies and selective restoration of specific lipoproteins are essential controls

    • Time-course experiments tracking bacterial loads, toxin production, and host responses provide crucial insights

  • Ethical considerations:

    • Implementing the 3Rs (Replacement, Reduction, Refinement) in experimental design

    • Developing in vitro alternatives when possible, such as organotypic skin models

Addressing these challenges requires multidisciplinary approaches combining molecular genetics, immunology, and advanced imaging techniques.

How can high-throughput approaches advance our understanding of lgt function across the B. cereus group?

Modern high-throughput technologies offer powerful approaches to elucidate lgt function across the diverse B. cereus group:

  • Comparative genomics:

    • Whole-genome sequencing of diverse B. cereus isolates reveals lgt sequence variation

    • Correlation with virulence phenotypes identifies potential structure-function relationships

    • Phylogenetic analysis has already revealed distinct clustering of pathogenic strains in clade I

  • Transcriptomics:

    • RNA-seq profiling of wild-type versus lgt mutants identifies downstream regulatory effects

    • Condition-specific expression patterns (e.g., gastrointestinal simulation ) reveal environmental regulation

    • Single-cell transcriptomics can identify population heterogeneity in lgt expression

  • Proteomics approaches:

    MethodApplicationKey Insights
    Global lipoproteinomicsComprehensive identification of lgt substratesSpecies-specific lipoprotein profiles
    Comparative secretomicsAssessing impact of lgt deletion on protein secretionIndirect effects on virulence factor export
    Membrane proteomicsDetermining membrane composition changesStructural impacts on bacterial surface
    PhosphoproteomicsMapping affected signaling pathwaysRegulatory networks linked to lgt function
  • High-content imaging:

    • Automated microscopy of host-pathogen interactions with fluorescently labeled bacteria

    • Quantification of adhesion, invasion, and host cell responses

    • Live-cell imaging to track spore germination dynamics in different mutants

  • Metabolomics:

    • Profiling metabolic changes in lgt mutants versus wild-type

    • Identifying metabolic bottlenecks that contribute to attenuated virulence

    • Linking metabolic adaptations to environmental conditions

These integrated approaches would provide a systems-level understanding of lgt function across the B. cereus group, potentially revealing new therapeutic targets and diagnostic markers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.