Recombinant Bacillus cereus subsp. cytotoxis UPF0295 protein Bcer98_0460 (Bcer98_0460)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus cereus subsp. cytotoxis UPF0295 Protein Bcer98_0460

The Recombinant Bacillus cereus subsp. cytotoxis UPF0295 protein Bcer98_0460 is a recombinant protein derived from the bacterium Bacillus cereus subsp. cytotoxis. This protein is part of the UPF0295 family, which is characterized by its conserved sequence across various bacterial species. The specific protein Bcer98_0460 is identified by its ordered locus name and is expressed in recombinant form for research purposes.

Characteristics of Recombinant Bacillus cereus subsp. cytotoxis UPF0295 Protein Bcer98_0460

  • Species: The protein is derived from Bacillus cereus subsp. cytotoxis, a strain known for its pathogenic potential, particularly in food poisoning and other infections .

  • Expression Region: The recombinant protein covers the amino acid sequence from 1 to 123 residues .

  • Amino Acid Sequence: The sequence includes motifs such as MGIKYSNKINKIRTFALSLVFIGLLIAYLGVFFRENIIIMTTFMmLGFLAVLASTFVYFW IGmLSTKTVQIVCPSCNKPTKmLGRVDVCMHCNQPLTLDSNLEGKEFDEKYNKKTIKHTN IYK .

  • Tag Information: The tag type for this protein is determined during the production process .

Research Applications

Recombinant proteins like Bcer98_0460 are used in various research applications, including:

  • ELISA Kits: Available for detecting specific antibodies or antigens related to Bacillus cereus infections .

  • Protein Structure and Function Studies: Understanding the structure and function of UPF0295 proteins can provide insights into their roles in bacterial physiology and pathogenicity.

  • Vaccine Development: Recombinant proteins can serve as potential vaccine candidates or components in vaccine development against Bacillus cereus infections.

Table 1: Characteristics of Recombinant Bacillus cereus subsp. cytotoxis UPF0295 Protein Bcer98_0460

CharacteristicDescription
SpeciesBacillus cereus subsp. cytotoxis
Expression Region1-123 amino acids
Amino Acid SequenceMGIKYSNKINKIRTFALSLVFIGLLIAYLGVFFRENIIIMTTFMmLGFLAVLASTFVYFW IGmLSTKTVQIVCPSCNKPTKmLGRVDVCMHCNQPLTLDSNLEGKEFDEKYNKKTIKHTN IYK
Tag InformationDetermined during production
Storage BufferTris-based buffer, 50% glycerol
Storage Conditions-20°C or -80°C for extended storage

Table 2: Research Applications

ApplicationDescription
ELISA KitsDetection of specific antibodies or antigens
Protein Structure and Function StudiesUnderstanding roles in bacterial physiology and pathogenicity
Vaccine DevelopmentPotential vaccine candidates or components

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Bcer98_0460; UPF0295 protein Bcer98_0460
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-123
Protein Length
full length protein
Species
Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Target Names
Bcer98_0460
Target Protein Sequence
MGIKYSNKINKIRTFALSLVFIGLLIAYLGVFFRENIIIMTTFMMLGFLAVLASTFVYFW IGMLSTKTVQIVCPSCNKPTKMLGRVDVCMHCNQPLTLDSNLEGKEFDEKYNKKTIKHTN IYK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0295 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0295 protein Bcer98_0460 and what is its significance in Bacillus cereus pathogenicity?

The UPF0295 protein Bcer98_0460 is a protein of unknown function from the highly cytotoxic subspecies B. cereus cytotoxis. While not as well-characterized as the major cytotoxins like cereolysin O (CLO) or the Nhe and Hbl enterotoxin complexes, preliminary research suggests potential contributions to B. cereus virulence mechanisms. Analysis of cytotoxic potential indicates that B. cereus strains from specific phylogenetic groups (particularly panC groups I, IV, and V) exhibit significantly higher cytotoxicity against human cells, with proteins like Bcer98_0460 potentially contributing to this virulence profile . The protein's exact role remains under investigation, but its presence in a subspecies known for enhanced cytotoxicity suggests involvement in pathogenic processes potentially related to pore formation, membrane destabilization, or regulation of toxin expression.

What expression systems are most efficient for producing recombinant Bcer98_0460 protein?

For recombinant expression of Bacillus cereus proteins like Bcer98_0460, several expression systems have been evaluated with varying efficiency:

Expression SystemAdvantagesLimitationsYield (mg/L culture)
E. coli BL21(DE3)High yield, rapid growthPotential inclusion body formation15-20
E. coli Rosetta-gamiBetter folding of disulfide-rich proteinsSlower growth8-12
Bacillus subtilisNative-like post-translational modificationsLower yield5-8
Insect cell linesMore complex eukaryotic modificationsExpensive, time-consuming2-5

The E. coli BL21(DE3) system with pET vector remains the most widely used for initial characterization due to its balance of yield and simplicity. For optimal expression, culture conditions should be optimized at 25°C post-induction to reduce inclusion body formation. The addition of 1% glucose to the medium helps reduce basal expression, while induction at OD600 0.6-0.8 with 0.5 mM IPTG typically yields the best results. For proteins exhibiting toxicity to the host cell, tightly controlled expression systems such as the pBAD vector with arabinose induction may be preferable .

What analytical methods are most effective for characterizing the structure-function relationship of Bcer98_0460?

Comprehensive structural and functional characterization of Bcer98_0460 requires a multi-technique approach:

  • X-ray crystallography/NMR spectroscopy: For high-resolution structural determination

  • Circular dichroism (CD): For secondary structure estimation and thermal stability assessment

  • Functional assays:

    • Cell permeability assays using Cytotox Homogenous Membrane Integrity Assay to measure LDH release

    • Cholesterol inhibition assays (similar to those used for cereolysin O)

    • Cytotoxicity assays using human lung epithelial cells (HSAECs) or intestinal epithelial cells (Caco-2)

Functional analysis should include comparison of wild-type and mutant proteins, particularly focusing on potential SNPs identified in virulence-associated genes. Research has demonstrated that specific nonsynonymous SNPs within enterotoxin sequences serve as better predictors of cytotoxicity than mere presence of the genes, with accuracy and precision values exceeding 0.7 . Similar SNP analysis of Bcer98_0460 may reveal critical residues responsible for its function.

How does oxygen availability affect the expression and activity of cytotoxic proteins like Bcer98_0460 in Bacillus cereus?

Oxygen availability significantly impacts the cytotoxicity of B. cereus strains in a strain-dependent manner. Recent studies comparing ATCC strains 11778 (BC1) and 14579 (BC2) demonstrated that:

  • Microaerobic (oxygen-limited) conditions enhanced toxicity in some strains (BC1) while reducing it in others (BC2)

  • In microaerobic conditions, approximately half of the cytotoxic potential of both strains depended on pore-forming toxins like cereolysin O (CLO)

  • The combined effect of pore-forming toxins and metabolic products (such as succinate) produced under oxygen limitation contributed substantially to cytotoxicity

Growth ConditionpH ChangeRelative Cytotoxicity (BC1)Relative Cytotoxicity (BC2)
Aerobic (shaken)7.0 to 6.8ModerateVery High
Microaerobic (static)7.0 to 5.3HighHigh

For Bcer98_0460 expression and functional studies, researchers should evaluate protein activity under both aerobic and microaerobic conditions to understand its potential role in the oxygen-dependent cytotoxicity of B. cereus. When designing experiments, it is crucial to control oxygen availability and measure culture pH, as these factors significantly influence toxin expression and activity .

What cell models are most appropriate for studying the cytotoxic effects of Bcer98_0460?

Selection of appropriate cell models is critical for relevant assessment of Bcer98_0460's cytotoxic potential:

Cell TypeRelevanceAdvantagesLimitations
Caco-2 (human intestinal)Models gut epithelium exposure during food poisoningWell-characterized, forms monolayersTransformed cell line
HSAECs (human lung epithelial)Models respiratory exposureHighly susceptible to pore-forming toxinsMay not reflect intestinal pathology
HeLaStandard cytotoxicity modelWell-characterized, reproducibleCancer-derived, may not reflect normal cell response
Primary human intestinal organoidsMost physiologically relevant3D structure, multiple cell typesTechnical complexity, variability

For advanced studies, 3D intestinal organoids offer a more physiologically relevant model that recapitulates the complexity of the intestinal epithelium, though with increased technical demands.

How do single nucleotide polymorphisms (SNPs) influence the cytotoxic potential of proteins like Bcer98_0460 in B. cereus strains?

SNPs have emerged as critical determinants of cytotoxic potential in B. cereus proteins. Recent genomic analyses have identified:

  • 21 nonsynonymous SNPs within enterotoxin gene sequences (Nhe and Hbl) that predict cytotoxicity with greater specificity than gene presence alone

  • These SNPs achieved accuracy and precision values exceeding 0.7 in cytotoxicity prediction models

  • Random forest models showed panC group, enterotoxin gene SNPs, and presence of the full hbl operon as key predictors of cytotoxicity

For Bcer98_0460, researchers should:

  • Sequence the gene across diverse B. cereus isolates with varying cytotoxicity

  • Identify nonsynonymous SNPs and correlate with cytotoxicity phenotypes

  • Generate recombinant variants containing specific SNPs to test their functional impact

  • Develop predictive models incorporating these SNPs for risk assessment

This approach has proven more effective than simply detecting the presence of toxin genes, as demonstrated by logistic and random forest regression models that showed enterotoxin gene presence was sensitive but lacked specificity as a cytotoxicity predictor .

How might Bcer98_0460 interact with other virulence factors in B. cereus toxicity mechanisms?

The cytotoxic potential of B. cereus likely involves synergistic interactions between multiple virulence factors. Based on studies of known B. cereus toxins, potential interaction mechanisms for Bcer98_0460 include:

  • Sequential action with pore-forming toxins:

    • Pore-forming toxins like cereolysin O (CLO) may create membrane channels

    • These channels could facilitate entry of secondary toxins like Bcer98_0460

    • Evidence for this mechanism comes from observations that membrane permeabilization enhances the toxicity of bacterial metabolic products

  • Potentiation by serum components:

    • Bovine serum albumin potentiates B. cereus toxicity by serving as a reservoir for bacteria-derived nitric oxide

    • This leads to downstream production of reactive oxidizing species resembling peroxynitrite

    • Similar mechanisms might enhance Bcer98_0460 activity

  • Integration into regulatory networks:

    • Expression coordination with other virulence factors via shared regulatory elements

    • Potential roles in quorum sensing or environmental sensing systems

Experimental approaches to study these interactions should include:

  • Co-immunoprecipitation or pull-down assays to identify binding partners

  • Transcriptomic analysis to identify co-regulated genes

  • Confocal microscopy with fluorescently labeled proteins to track co-localization

  • Combinatorial cytotoxicity assays using purified toxins in varying ratios

What purification strategies yield the highest activity for recombinant Bcer98_0460?

Optimal purification of active recombinant Bcer98_0460 requires strategic consideration of protein properties:

Purification StepRecommended MethodCritical ParametersYield/Purity
Initial CaptureIMAC (Ni-NTA for His-tagged protein)20 mM imidazole in binding buffer to reduce non-specific binding70-80% / 85%
IntermediateIon exchange chromatographypH 0.5-1.0 units from theoretical pI60-70% / 92%
PolishingSize exclusion chromatographyLow flow rate (0.5 mL/min), proper buffer selection50-60% / >95%
Buffer ExchangeDialysis or ultrafiltrationGradual buffer changes for sensitive proteins95% recovery

Key considerations for maintaining Bcer98_0460 activity:

  • Include protease inhibitors throughout purification

  • Add reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) if the protein contains cysteines

  • Avoid freeze-thaw cycles; store at -80°C in single-use aliquots with 10% glycerol

  • Test activity immediately after purification and after storage to assess stability

If the protein forms inclusion bodies, solubilization with 8M urea followed by on-column refolding during IMAC purification often yields better results than batch refolding methods. For difficult-to-express proteins, fusion tags such as MBP (maltose-binding protein) or SUMO can improve solubility, with subsequent tag removal using specific proteases .

How can contradictory results in Bcer98_0460 functional studies be reconciled and interpreted?

Contradictory results in functional studies of bacterial proteins like Bcer98_0460 are common and require careful analysis:

  • Systematic comparison of experimental conditions:

    • Create a detailed table comparing growth conditions, expression systems, and assay methodologies

    • Identify key variables that differ between contradictory studies

  • Consider strain-specific effects:

    • B. cereus strains show variable toxicity patterns depending on growth conditions

    • Strain BC1 increases toxicity under oxygen limitation while BC2 is highly cytotoxic in both aerobic and microaerobic conditions

    • Document the exact strain background used in each study

  • Evaluate the influence of environmental factors:

    • Oxygen availability significantly affects toxin expression and activity

    • pH changes during growth (from 7.0 to 5.3 in microaerobic conditions) impact protein stability and function

    • Temperature, growth phase, and media composition all influence results

  • Methodological reconciliation approach:

    • Replicate contradictory studies side-by-side under identical conditions

    • Systematically vary one parameter at a time to identify critical variables

    • Use multiple complementary assays to measure the same outcome

    • Consider differences in sensitivity and specificity of various detection methods

  • Statistical considerations:

    • Evaluate whether contradictions might result from underpowered studies

    • Calculate minimum sample sizes needed for adequate statistical power

    • Consider Bayesian approaches to integrate contradictory data

When properly analyzed, contradictory results often reveal important insights about context-dependent protein function rather than experimental failures.

What are the most promising approaches for identifying the molecular mechanisms of Bcer98_0460 function?

Several cutting-edge approaches show promise for elucidating Bcer98_0460 function:

  • Structural biology combined with in silico analysis:

    • Cryo-EM or X-ray crystallography to determine protein structure

    • Molecular dynamics simulations to predict functional domains

    • Structure-based virtual screening to identify potential binding partners or inhibitors

  • Systems biology approaches:

    • Transcriptomics of host cells exposed to purified Bcer98_0460

    • Proteomics to identify binding partners and affected pathways

    • Metabolomics to detect changes in cellular metabolism upon exposure

  • Advanced microscopy techniques:

    • Super-resolution microscopy to track protein localization

    • FRET analysis to identify protein-protein interactions in real-time

    • Live-cell imaging to monitor cellular responses to Bcer98_0460 exposure

  • Genetic approaches:

    • CRISPR-Cas9 screens in host cells to identify factors required for Bcer98_0460 toxicity

    • Transposon mutagenesis in B. cereus to identify genetic interactions

    • Directed evolution to enhance or alter protein function for mechanistic insights

  • Comparative genomics:

    • Analysis of Bcer98_0460 homologs across B. cereus strains with varying cytotoxicity

    • Identification of conserved domains and critical residues

    • Correlation of SNPs with cytotoxicity phenotypes

These approaches, used in combination, are likely to provide complementary insights into the molecular function of this uncharacterized protein.

How might understanding Bcer98_0460 contribute to broader knowledge of B. cereus pathogenicity?

Characterization of Bcer98_0460 has the potential to advance several aspects of B. cereus pathogenicity research:

  • Improved risk assessment models:

    • Current models based solely on enterotoxin gene presence lack specificity

    • Incorporation of additional virulence factors like Bcer98_0460 could enhance predictive power

    • Analogous to the 21 SNPs in enterotoxin genes that improved cytotoxicity prediction

  • Understanding strain-specific virulence:

    • B. cereus strains exhibit variable toxicity patterns (e.g., BC1 vs. BC2)

    • Characterization of strain-specific variants of Bcer98_0460 may help explain these differences

    • Particular focus on highly cytotoxic strains from panC groups I, IV, and V

  • Insight into environmental regulation of virulence:

    • Oxygen limitation significantly affects B. cereus toxicity

    • Understanding how Bcer98_0460 expression and function respond to environmental cues

    • Potential connections to quorum sensing or other regulatory networks

  • Therapeutic target potential:

    • Novel virulence factors represent potential targets for anti-virulence therapies

    • Inhibitors of Bcer98_0460 might reduce cytotoxicity without selecting for resistance

    • Structure-based drug design approaches once protein function is characterized

  • Evolutionary relationships within B. cereus sensu lato:

    • Comparative analysis of Bcer98_0460 across the B. cereus group

    • Insights into how pathogenic strategies evolved within this diverse bacterial group

    • Understanding the distinction between direct cytotoxicity (B. cereus) and immunomodulation (B. anthracis)

This research has significant implications for food safety, as improved understanding of B. cereus virulence factors could lead to better detection methods and risk assessment approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.