Recombinant Bacillus cereus Undecaprenyl-diphosphatase 1 (uppP1)

Shipped with Ice Packs
In Stock

Description

Biochemical Role of UppP1

UppP1 catalyzes the dephosphorylation of UPP to UP, a rate-limiting step in the lipid II cycle . This reaction is vital for maintaining cell wall integrity and enabling resistance to antibiotics like bacitracin, which targets UPP . In B. cereus, UppP1 operates alongside other phosphatases (e.g., BcrC) to ensure UP availability, with functional redundancy observed in related species like Bacillus subtilis .

Key reactions:

  • UPPUppP1UP+Pi\text{UPP} \xrightarrow{\text{UppP1}} \text{UP} + \text{P}_i

  • UP is reused for lipid II synthesis, while UPP is recycled from cell wall precursors .

Recombinant Production and Purification

Recombinant UppP1 (UniProt ID: B9IWT7) is expressed in heterologous systems (e.g., E. coli) using codon-optimized vectors. Key parameters include:

PropertyDetail
Gene ID22938256 (BCERE0007_RS18690)
Protein Size146 amino acids
Molecular Weight~16 kDa
Purity>85% (SDS-PAGE verified)
Storage ConditionsTris buffer, 50% glycerol, -20°C/-80°C
ApplicationsWestern blot, ELISA, enzymatic assays

Source: Aviva Systems Biology .

4.1. Essentiality in Cell Wall Homeostasis

Depletion of UppP1 in Bacillus species leads to:

  • Severe cell wall defects (e.g., loss of rod shape, impaired sporulation) .

  • Activation of the σ<sup>M</sup>-dependent cell envelope stress response (CESR) .

  • Increased susceptibility to bacitracin .

4.2. Enzymatic Activity

  • pH Optimum: 7.5–8.0 .

  • Metal Dependence: Mg<sup>2+</sup> or Mn<sup>2+</sup> enhances activity .

  • Kinetic Parameters: KmK_m for UPP ranges from 15–30 μM in homologs .

4.3. Synthetic Lethality

In B. subtilis, UppP and BcrC form a synthetic lethal pair; deletion of both is fatal . While direct evidence in B. cereus is limited, CRISPRi studies suggest similar redundancy .

Biotechnological and Therapeutic Implications

  • Antibiotic Development: UppP1 is a potential target for novel antibiotics, given its role in bacitracin resistance .

  • Vaccine Engineering: CRISPR/Cas9-mediated gene editing (as demonstrated in B. anthracis) could facilitate UppP1 knockout for attenuated vaccine strains .

Unresolved Questions

  • Regulatory Mechanisms: How UppP1 expression is modulated under stress (e.g., bacitracin exposure) remains unclear .

  • Structural Dynamics: High-resolution structures of B. cereus UppP1 are needed to elucidate substrate-binding specifics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
uppP1; bacA1; upk1; BC_0677; Undecaprenyl-diphosphatase 1; Bacitracin resistance protein 1; Undecaprenyl pyrophosphate phosphatase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)
Target Names
uppP1
Target Protein Sequence
MEQFYYVLKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGFSFELLVNSASLLAVL LIYRNDLIRLTKNGLSYIFTRAEDAKSDFFFIIYLVIATIPAGVIGVLFKDYIDQYLKGV KMVGISLLITAVGLWIIRNLRGRKNDGDLSMKDAIIVGLAQACALIPGISRSGATIVAAM LLGMKQETALRFSFLLYIPVSLGGLLLSITDIANDPNLDTLFVPYVVAFIATFIMTYISL KWFMNIMAKGNLKYFSFYCIIVGVLTLIFL
Uniprot No.

Target Background

Function

This recombinant Bacillus cereus Undecaprenyl-diphosphatase 1 (UppP1) catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers bacitracin resistance.

Database Links

KEGG: bce:BC0677

STRING: 226900.BC0677

Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus cereus Undecaprenyl-diphosphatase 1 (uppP1)?

Bacillus cereus Undecaprenyl-diphosphatase 1 (uppP1) is a membrane protein that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP). This enzyme, also known as Bacitracin resistance protein 1 and Undecaprenyl pyrophosphate phosphatase 1, is encoded by the uppP1 gene (synonyms: bacA1, upk1) . The protein consists of 270 amino acids and functions as a crucial component in bacterial cell wall biosynthesis. In B. cereus, this enzyme has the UniProt ID Q81HV4 and EC number 3.6.1.27 . The full amino acid sequence has been characterized and is available for reference in protein databases and recombinant protein catalogs .

What is the physiological role of uppP1 in bacterial cell wall synthesis?

Undecaprenyl-diphosphatase 1 plays an essential role in the lipid II cycle of bacterial cell wall synthesis. The bacterial cell wall is crucial for cell integrity, protecting it from environmental stressors and maintaining cellular morphology. The lipid II cycle provides cell wall building blocks that are assembled inside the cytoplasm and then transported to the outside for incorporation into the growing peptidoglycan layer .

In this cycle, uppP1 is responsible for recycling the carrier molecule undecaprenyl phosphate (UP) by dephosphorylating undecaprenyl pyrophosphate (UPP). This recycling step is indispensable for continued cell wall synthesis, as it maintains an adequate pool of UP carrier molecules . Research on the related B. subtilis model indicates that UPP phosphatase activity is essential for normal growth and cell morphology, particularly during exponential growth phases when rapid cell wall synthesis occurs .

How does uppP1 contribute to antibiotic resistance in bacteria?

The uppP1 enzyme plays a significant role in bacterial resistance to certain antibiotics, particularly bacitracin. Bacitracin exerts its antibacterial effect by binding to UPP, thus preventing its dephosphorylation to UP. This binding effectively depletes the UP pool, leading to an arrest of the lipid II cycle and eventually cell death .

UPP phosphatases such as uppP1 contribute to bacitracin resistance through several mechanisms:

  • Competitive substrate binding: UPP phosphatases compete with bacitracin for the same target molecule (UPP), thereby reducing the antibiotic's effectiveness .

  • UP pool maintenance: By efficiently recycling UPP to UP, these enzymes help maintain adequate levels of the carrier molecule even in the presence of bacitracin .

  • Cell envelope stress response: In B. subtilis, expression of the UPP phosphatase BcrC (functionally similar to uppP1) is upregulated under cell envelope stress conditions caused by bacitracin, providing an adaptive response mechanism .

This resistance mechanism is particularly relevant in clinical settings where bacitracin is used to treat infections caused by Gram-positive bacteria.

How does the function of uppP1 compare with UppP in other Bacillus species?

While uppP1 from B. cereus and UppP from other Bacillus species (like B. subtilis) share the same fundamental enzymatic function of dephosphorylating UPP to UP, there are important functional differences between these homologs:

  • Physiological redundancy: In B. subtilis, UppP works alongside another UPP phosphatase called BcrC. Research has demonstrated that uppP and bcrC represent a synthetic lethal gene pair in B. subtilis, meaning that while deletion of either gene alone is tolerable, simultaneous deletion of both genes is lethal . This indicates functional redundancy between these phosphatases, although they are not completely interchangeable.

  • Developmental roles: UppP in B. subtilis plays a crucial role during sporulation, whereas BcrC does not appear essential for this process . This suggests that undecaprenyl phosphatases may have specialized functions during different developmental stages or growth conditions.

  • Stress response regulation: The expression of bcrC in B. subtilis is upregulated under cell envelope stress conditions, particularly in response to bacitracin. In contrast, uppP expression is not significantly affected by these stressors . This indicates different regulatory mechanisms and potentially different roles in the cell envelope stress response.

Understanding these functional differences can provide insights into bacterial adaptation mechanisms and potential targets for antimicrobial development.

What enzymatic parameters characterize recombinant uppP1 activity?

The enzymatic activity of recombinant uppP1 can be characterized by several key parameters, although specific values for B. cereus uppP1 are not directly provided in the search results. Based on related UPP phosphatases, the following parameters are typically assessed:

  • Substrate specificity: uppP1 is highly specific for undecaprenyl pyrophosphate (UPP) as its substrate. The enzyme catalyzes the dephosphorylation reaction: UPP → UP + Pi .

  • pH optimum: UPP phosphatases typically function optimally in the neutral to slightly alkaline pH range (pH 7.0-8.0), consistent with the bacterial cytoplasmic membrane environment.

  • Metal ion requirements: Many phosphatases require divalent metal ions as cofactors for optimal activity. Mg²⁺ or Mn²⁺ are commonly required for UPP phosphatases.

  • Inhibition profile: UPP phosphatases are specifically inhibited by bacitracin, which binds to their substrate (UPP). This property is relevant for both functional assays and understanding antibiotic mechanisms .

For experimental work with recombinant uppP1, researchers should determine these parameters empirically under their specific assay conditions to ensure optimal enzymatic activity.

What are the recommended protocols for handling recombinant uppP1 protein?

When working with recombinant Bacillus cereus uppP1 protein, the following handling protocols are recommended to maintain stability and activity:

  • Storage conditions: Store the lyophilized protein at -20°C/-80°C upon receipt. Once reconstituted, working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided .

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening to bring the contents to the bottom

    • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • For long-term storage, add glycerol to a final concentration of 5-50% (typically 50% is recommended) and aliquot before storing at -20°C/-80°C

  • Buffer conditions: Tris/PBS-based buffer with 6% Trehalose at pH 8.0 is an appropriate storage buffer for maintaining protein stability .

  • Handling precautions: As with all research reagents, recombinant uppP1 is not for human consumption and should be handled according to standard laboratory safety practices for recombinant proteins .

These recommendations are based on commercial supplier protocols but may be optimized for specific experimental conditions.

How can researchers effectively express and purify recombinant uppP1?

For efficient expression and purification of recombinant uppP1, the following methodological approach is recommended:

  • Expression system selection: E. coli is the preferred heterologous expression system for B. cereus uppP1 . Specifically, E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) may improve yields.

  • Construct design:

    • Include the full-length sequence (amino acids 1-270) to preserve complete enzymatic function

    • Add an N-terminal His-tag to facilitate purification

    • Use a vector with an inducible promoter (e.g., T7) for controlled expression

  • Expression conditions:

    • Culture at lower temperatures (16-25°C) after induction to promote proper folding

    • Use lower inducer concentrations to prevent formation of inclusion bodies

    • Consider supplementing with specific lipids to aid membrane protein folding

  • Membrane extraction and purification:

    • Extract membrane fraction using mild detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS)

    • Purify using Ni-NTA affinity chromatography, leveraging the His-tag

    • Consider size exclusion chromatography as a polishing step

    • Verify purity by SDS-PAGE (>90% purity is achievable)

  • Activity verification:

    • Conduct enzymatic assays to confirm that the purified protein retains UPP phosphatase activity

    • Compare activity to known standards or previously characterized batches

This protocol can be adapted based on specific research requirements and available equipment.

What assays are available for measuring uppP1 enzymatic activity?

Several assay methods can be employed to measure the enzymatic activity of uppP1:

  • Phosphate release assays:

    • Malachite green assay: Measures released inorganic phosphate from UPP dephosphorylation

    • EnzChek Phosphate Assay: A more sensitive fluorescence-based method for detecting phosphate release

  • Substrate depletion assays:

    • HPLC-based methods to monitor the conversion of UPP to UP

    • Radioactive assays using ³²P-labeled UPP as substrate

  • NMR-based assays:

    • Real-time NMR monitoring can be used to track enzymatic conversions involving UDP-sugars, which involve similar phosphatase activities

    • This approach allows for unambiguous detection of reaction intermediates and products

  • Coupled enzyme assays:

    • Link UPP dephosphorylation to other enzymatic reactions that produce measurable signals

    • These assays can provide continuous monitoring capabilities

  • Bacitracin antagonism assays:

    • Measure uppP1 activity indirectly through its ability to counteract bacitracin inhibition

    • This approach is particularly relevant for studying the role of uppP1 in antibiotic resistance

Each assay has specific advantages and limitations regarding sensitivity, throughput, and equipment requirements. The choice of assay should be guided by the specific research questions and available resources.

How does uppP1 interact with the bacterial cell envelope stress response system?

Research on related UPP phosphatases in B. subtilis provides insights into how uppP1 might interact with bacterial cell envelope stress response (CESR) systems:

  • Stress sensing and regulation: In B. subtilis, expression of the UPP phosphatase BcrC (functionally similar to uppP1) is upregulated under cell envelope stress conditions, particularly in response to bacitracin. This regulation suggests that UPP phosphatases are integrated into stress response pathways that monitor cell wall integrity .

  • Feedback mechanisms: Limitations in UPP phosphatase levels lead to UP shortage, which is sensed by the cell. This sensing mechanism triggers compensatory responses, including upregulation of phosphatase expression. This homeostatic feedback renders BcrC more important during growth than UppP in B. subtilis, particularly in defense against cell envelope stress .

  • Promoter activity regulation: The activity of certain promoters (e.g., P₁* in B. subtilis) depends on UPP phosphatase levels and is further modulated by the undecaprenol kinase DgkA. This suggests complex regulatory networks involving multiple enzymes of the lipid II cycle .

  • Differential roles during stress: While both BcrC and UppP perform the same enzymatic function in B. subtilis, BcrC appears more important for managing cell envelope stress, while UppP is crucial for normal sporulation. This functional specialization may extend to uppP1 in B. cereus under different physiological conditions .

Understanding these interactions is crucial for developing strategies to combat bacterial infections, particularly in the context of antibiotic resistance.

What approaches can be used to study the role of uppP1 in bacitracin resistance?

To investigate the role of uppP1 in bacitracin resistance, researchers can employ several sophisticated approaches:

  • Genetic manipulation strategies:

    • Gene knockout/knockdown studies to assess the contribution of uppP1 to bacitracin resistance

    • Complementation assays with wild-type or mutant uppP1 to confirm phenotypes

    • Overexpression studies to determine if elevated uppP1 levels increase bacitracin resistance

  • Minimal Inhibitory Concentration (MIC) determination:

    • Comparative MIC assays between wild-type and uppP1-modified strains to quantify changes in bacitracin sensitivity

    • Dose-response studies to characterize the relationship between uppP1 expression levels and bacitracin resistance

  • Competition assays:

    • In vitro biochemical assays to measure competition between uppP1 and bacitracin for UPP binding

    • Equilibrium binding studies to determine relative affinities

  • Transcriptional response analysis:

    • RNA-seq or qPCR to monitor changes in uppP1 expression in response to bacitracin exposure

    • Promoter-reporter fusion constructs to visualize uppP1 regulation in real-time

  • Structural studies:

    • Protein crystallography or cryo-EM to determine how uppP1 interacts with its substrate

    • In silico modeling to predict bacitracin binding sites and competition mechanisms

  • Lipid II cycle analysis:

    • Metabolic labeling to track changes in cell wall precursor pools in response to bacitracin and uppP1 modifications

    • Measurement of UP/UPP ratios to assess the impact of bacitracin on carrier lipid recycling

These approaches, used in combination, can provide comprehensive insights into the mechanistic basis of uppP1-mediated bacitracin resistance.

How can researchers investigate the potential role of uppP1 in B. cereus pathogenesis?

Investigating the potential role of uppP1 in B. cereus pathogenesis requires multidisciplinary approaches:

  • Virulence model systems:

    • Establish appropriate infection models (cell culture, invertebrate, or vertebrate) to assess the impact of uppP1 modifications on B. cereus virulence

    • Compare the virulence of wild-type, uppP1-knockout, and uppP1-overexpressing strains

  • Cell wall integrity analysis:

    • Examine changes in cell wall composition and integrity in uppP1-modified strains

    • Assess how these changes affect bacterial survival under host-relevant stress conditions (pH, antimicrobial peptides, etc.)

  • Host-pathogen interaction studies:

    • Investigate how uppP1-dependent changes in cell wall structure affect recognition by host immune cells

    • Determine if uppP1 activity influences the production or presentation of pathogen-associated molecular patterns (PAMPs)

  • Comparative genomics:

    • Analyze uppP1 conservation and variation across pathogenic and non-pathogenic Bacillus species

    • Research suggests that certain UPP phosphatase genes may be restricted to pathogenic Bacillus species, including B. anthracis and B. thuringiensis

  • Antimicrobial resistance implications:

    • Evaluate how uppP1-mediated bacitracin resistance might contribute to bacterial persistence during infection

    • Assess potential cross-resistance to host antimicrobial defenses

  • Metabolic adaptation:

    • Investigate if uppP1 activity contributes to metabolic adaptations necessary for survival in host environments

    • Examine connections between cell wall metabolism and other virulence-associated pathways

This research direction is particularly relevant considering that B. cereus is a food-poisoning bacterium, and understanding the contributions of cell wall homeostasis to its pathogenicity could lead to new control strategies.

What are common challenges in working with recombinant uppP1 and how can they be addressed?

Researchers working with recombinant uppP1 may encounter several challenges:

  • Low expression yields:

    • Problem: Membrane proteins like uppP1 often express poorly in heterologous systems

    • Solution: Optimize expression conditions by testing different E. coli strains (e.g., C41(DE3), C43(DE3)), lower induction temperatures (16-20°C), and reduced inducer concentrations. Consider using specialized vectors designed for membrane protein expression .

  • Protein inactivity after purification:

    • Problem: Loss of enzymatic activity during extraction or purification

    • Solution: Use milder detergents for membrane extraction, include lipids in purification buffers to maintain a native-like environment, and avoid harsh elution conditions. Verify activity immediately after purification .

  • Protein aggregation:

    • Problem: Formation of inactive aggregates during storage

    • Solution: Store in buffer containing 6% trehalose at pH 8.0, add glycerol (5-50%) for long-term storage, aliquot to avoid freeze-thaw cycles, and store at recommended temperatures (-20°C/-80°C) .

  • Inconsistent enzymatic assays:

    • Problem: Variable or unreliable activity measurements

    • Solution: Ensure substrate quality and consistency, optimize assay conditions (pH, temperature, ion concentrations), include appropriate controls, and normalize results to protein concentration.

  • Difficulty in substrate accessibility:

    • Problem: Limited availability of the natural substrate (UPP)

    • Solution: Consider using synthetic substrate analogs, develop coupled enzyme assays, or use indirect methods such as bacitracin antagonism assays to assess activity .

These methodological challenges can be addressed through careful optimization and adaptation of protocols to the specific properties of uppP1.

How can researchers design effective inhibitors targeting uppP1?

Designing effective inhibitors targeting uppP1 requires a systematic approach:

  • Structure-based design strategy:

    • Utilize computational modeling based on the amino acid sequence to predict the three-dimensional structure of uppP1

    • Identify potential binding pockets and catalytic sites

    • Design molecules that complement these sites based on electrostatic and hydrophobic interactions

  • Substrate mimicry approach:

    • Develop analogs of UPP that can competitively bind to the active site

    • Incorporate non-hydrolyzable phosphate mimics to create competitive inhibitors

    • Consider the membrane-embedded nature of both the enzyme and substrate when designing inhibitors

  • High-throughput screening methodology:

    • Establish a reliable enzymatic assay suitable for high-throughput format

    • Screen diverse chemical libraries for inhibitory activity

    • Validate hits using secondary assays and dose-response studies

  • Natural product exploration:

    • Investigate known antibiotics that target cell wall synthesis (like bacitracin) for structural insights

    • Screen natural product extracts for novel inhibitory compounds

    • Characterize the mechanism of action of any identified inhibitors

  • Validation and optimization workflow:

    • Confirm target engagement using biochemical and cellular assays

    • Assess specificity by testing against related phosphatases

    • Optimize lead compounds for improved potency, selectivity, and pharmacokinetic properties

    • Evaluate antibacterial activity against B. cereus and related pathogens

  • Combination approaches:

    • Consider dual-targeting inhibitors that affect multiple steps in the lipid II cycle

    • Explore synergistic combinations with existing antibiotics

This systematic approach can lead to the development of novel inhibitors that may serve as leads for new antibacterial agents specifically targeting pathogenic Bacillus species.

What controls should be included in experimental studies of uppP1?

Robust experimental design for uppP1 studies should include appropriate controls:

  • Enzymatic activity assays:

    • Positive control: Known active UPP phosphatase (e.g., commercially available or previously characterized batch)

    • Negative control: Heat-inactivated enzyme or reaction mixture without enzyme

    • Substrate control: Reaction with non-hydrolyzable substrate analog

    • Inhibition control: Reaction in the presence of known inhibitor (e.g., bacitracin)

  • Expression and purification verification:

    • SDS-PAGE analysis: To confirm protein size and purity (>90% purity is achievable)

    • Western blot: Using anti-His antibodies to verify the presence of the tagged protein

    • Mass spectrometry: For precise identification of the purified protein

  • Functional complementation studies:

    • Positive control: Wild-type strain or knockout complemented with functional uppP1

    • Negative control: Empty vector control

    • Cross-complementation: UPP phosphatases from other species to assess functional conservation

  • Bacitracin resistance assays:

    • Susceptibility gradient: Range of bacitracin concentrations to establish dose-response relationship

    • Comparative controls: Strains with known bacitracin resistance/sensitivity profiles

    • Alternative antibiotic controls: To confirm specificity of uppP1-mediated resistance

  • Cell wall integrity studies:

    • Morphological controls: Wild-type cells under normal and stress conditions

    • Cell wall targeting control: Treatment with different cell wall antibiotics to compare specificity

    • Growth phase controls: Exponential vs. stationary phase cells to account for physiological variations

Incorporating these controls ensures experimental rigor and facilitates accurate interpretation of results in uppP1 research.

What are emerging approaches for studying uppP1 in the context of synthetic biology?

Synthetic biology offers innovative approaches for studying uppP1:

  • Engineered cell wall biosynthesis pathways:

    • Design minimal synthetic pathways incorporating uppP1 to study its function in isolation

    • Create chimeric enzymes combining domains from different UPP phosphatases to explore structure-function relationships

    • Develop orthogonal lipid II cycles with non-native carriers to assess uppP1 substrate specificity

  • Biosensor development:

    • Design genetic circuits that respond to changes in UP/UPP ratios

    • Create reporters that visualize uppP1 activity in real-time in living cells

    • Develop high-throughput screening systems for uppP1 inhibitors

  • Protein engineering approaches:

    • Apply directed evolution to generate uppP1 variants with enhanced activity or altered substrate specificity

    • Design stability-enhanced versions for improved recombinant expression

    • Create fusion proteins that co-localize uppP1 with other lipid II cycle enzymes

  • Cell-free expression systems:

    • Establish membrane-mimetic environments for functional studies of uppP1 outside living cells

    • Develop coupled in vitro transcription-translation systems to express and study uppP1 without cellular constraints

  • Genome engineering applications:

    • Apply CRISPR-Cas systems for precise modification of uppP1 in its native context

    • Create conditional expression systems to study essential uppP1 functions

    • Generate reporter strains for high-throughput phenotypic screening

These synthetic biology approaches can provide new insights into uppP1 function while potentially yielding biotechnological applications in antibiotic development and bacterial engineering.

How might the study of uppP1 contribute to new antimicrobial strategies?

Research on uppP1 presents several promising avenues for novel antimicrobial development:

  • Target-based drug design:

    • The essential nature of UPP phosphatase activity makes uppP1 an attractive target for new antibiotics

    • Structure-based design of specific inhibitors could yield compounds with selective activity against pathogenic Bacillus species

    • Unlike many targets, inhibition of uppP1 would affect a pathway not targeted by many current antibiotics, potentially addressing resistance issues

  • Combination therapy approaches:

    • Understanding how uppP1 contributes to bacitracin resistance could inform rational combination therapies

    • Inhibitors targeting uppP1 might synergize with existing cell wall-targeting antibiotics

    • Dual-targeting strategies affecting multiple steps in cell wall synthesis could reduce resistance development

  • Species-specific targeting:

    • Research suggests that certain UPP phosphatase genes may be restricted to pathogenic Bacillus species, including B. anthracis and B. thuringiensis

    • This specificity could enable development of narrow-spectrum antibiotics with reduced impact on beneficial microbiota

  • Antivirulence strategies:

    • Rather than killing bacteria, modulating uppP1 activity might attenuate virulence

    • Sub-inhibitory targeting of uppP1 could compromise cell wall integrity enough to enhance host defense mechanisms

    • This approach might reduce selective pressure for resistance development

  • Diagnostic applications:

    • uppP1 sequence variations between species could be exploited for rapid diagnostic tests

    • Functional assays measuring uppP1 activity might predict antibiotic susceptibility

The critical role of uppP1 in bacterial cell wall synthesis, combined with its potential species specificity, makes it a promising focus for next-generation antimicrobial strategies targeting pathogenic Bacillus species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.