Recombinant Bacillus cereus Undecaprenyl-diphosphatase 2 (uppP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
uppP2; bacA2; BCE33L0594; Undecaprenyl-diphosphatase 2; Bacitracin resistance protein 2; Undecaprenyl pyrophosphate phosphatase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bacillus cereus (strain ZK / E33L)
Target Names
uppP2
Target Protein Sequence
MEQFYYILKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGFSFELLVNSASLLAVL LIYRNDLIRLTKNGLSYIFTRAEDAKSDFFFIIYLVIATIPAGVIGVLFKDYIDQYLKGV KMVGISLLITAVGLWIIRNLRGRKNDGDLSMKDAIIVGLAQACALIPGISRSGATIVAAM LLGMKQETALRFSFLLYIPVSLGGLLLSITDIAKDPNLDTLFVPYIVAFIATFIMTYISL KWFMNIMAKGNLKYFSFYCIIVGVLTLIFL
Uniprot No.

Target Background

Function

Function: Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers resistance to bacitracin.

Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase 2 (uppP2) and what is its primary function in Bacillus cereus?

Undecaprenyl-diphosphatase 2 (uppP2) is an enzyme found in Bacillus cereus that plays a crucial role in bacitracin resistance. The enzyme shares approximately 56% amino acid identity with the uppP of Escherichia coli, which is known to confer resistance to bacitracin . The primary function of uppP2 is to catalyze the dephosphorylation of undecaprenyl-pyrophosphate, a critical carrier lipid involved in bacterial cell wall biosynthesis. This dephosphorylation activity is essential for recycling the lipid carrier and maintaining cell wall integrity in the presence of antimicrobial compounds like bacitracin that target this pathway .

Within the B. cereus group, uppP2 is part of a conserved bacitracin resistance gene cluster flanked by rRNA operons. This specific genomic organization is consistently maintained across the B. cereus group species, highlighting the importance of this enzyme in the bacteria's survival strategy . The enzyme's activity directly counteracts bacitracin's mechanism of action, which involves binding to undecaprenyl-pyrophosphate and preventing its recycling.

How does the genomic context of uppP2 differ between B. cereus and other Bacillus species?

The genomic context of uppP2 in B. cereus is distinctly different from that in other Bacillus species, representing a key evolutionary adaptation. In B. cereus and related species within the B. cereus group, the uppP2 gene is specifically incorporated into a bacitracin resistance gene cluster that is flanked by rRNA operons . This genomic architecture is highly conserved within the B. cereus group, suggesting its importance for these bacteria's survival.

In contrast, most other Bacillus species either lack this specific gene cluster entirely or possess it at a very low frequency. For instance, only two Bacillus amyloliquefaciens strains and one B. subtilis strain were found to possess this cluster, indicating that these species rarely acquire this genetic element . Furthermore, in species like B. amyloliquefaciens, B. vallismortis, B. velezensis, and B. subtilis, the uppP gene is typically replaced by the bcrC gene homolog. While bcrC encodes a protein with the same undecaprenyl-diphosphatase activity, it comprises different domain sequences .

Additionally, variations in the relative positions of two-component system genes were observed in B. vallismortis, B. amyloliquefaciens, B. velezensis, and B. subtilis, further distinguishing their genomic organization from that of the B. cereus group . These differences highlight the unique evolutionary trajectory of uppP2 and its associated gene cluster in B. cereus compared to other Bacillus species.

What are the optimal expression systems for recombinant B. cereus uppP2 production?

The choice of expression system for recombinant B. cereus uppP2 significantly impacts protein yield, functionality, and downstream applications. Based on available research data, four main expression systems have shown promise for uppP2 production, each with specific advantages:

Expression SystemAdvantagesRecommended ApplicationsRelative YieldTurnaround Time
E. coliHighest yield, cost-effective, well-established protocolsStructural studies, biochemical characterizationHighShort
YeastGood yield, some post-translational modificationsFunctional studies requiring moderate modificationsMedium-HighShort-Medium
Insect cells with baculovirusMany post-translational modifications for correct protein foldingFunctional assays requiring proper foldingMediumMedium-Long
Mammalian cellsMost complete post-translational modifications, protein activity retentionComplex functional studies, interaction studiesLowLong

For optimal expression in E. coli, researchers should consider codon optimization for B. cereus genes, as codon usage differences can significantly impact expression levels. Additionally, fusion tags (such as His6, MBP, or GST) can enhance solubility and facilitate purification of the recombinant protein.

What purification strategies are most effective for obtaining active recombinant uppP2?

Purification of recombinant uppP2 requires careful consideration of the protein's biochemical properties and intended downstream applications. The following methodological approach is recommended based on current research practices:

  • Initial Extraction: For membrane-associated proteins like uppP2, use gentle detergents (such as n-dodecyl-β-D-maltoside or CHAPS) at concentrations just above their critical micelle concentration to solubilize the protein without denaturation.

  • Affinity Chromatography: Utilize affinity tags (His6, GST, or MBP) for initial capture. For His-tagged uppP2, immobilized metal affinity chromatography (IMAC) with Ni-NTA or Co-NTA resins under native conditions yields good results. Include low concentrations of detergent in all buffers to maintain protein solubility.

  • Ion Exchange Chromatography: As a second purification step, anion or cation exchange chromatography (depending on the protein's isoelectric point) can remove contaminants with different charge properties than uppP2.

  • Size Exclusion Chromatography: As a final polishing step, gel filtration can separate protein aggregates, oligomers, and remaining contaminants while also allowing buffer exchange into a stabilizing formulation.

  • Activity Verification: Throughout purification, monitor enzymatic activity using a phosphatase assay that measures either inorganic phosphate release or substrate depletion to ensure that active protein is being recovered.

How can researchers measure the enzymatic activity of uppP2 in vitro?

Measuring the enzymatic activity of uppP2 requires the development of robust assays that can quantify the dephosphorylation of undecaprenyl-pyrophosphate. The following methodological approaches are recommended:

  • Malachite Green Phosphate Assay: This colorimetric method detects inorganic phosphate released during the dephosphorylation reaction. The assay mixture should contain purified uppP2, undecaprenyl-pyrophosphate substrate (either synthetic or extracted from bacteria), appropriate buffer (typically at pH 7.5-8.0), and divalent cations (Mg²⁺ or Mn²⁺) as cofactors. After incubation, add malachite green reagent to measure released phosphate spectrophotometrically at 620-650 nm.

  • Radiolabeled Substrate Assay: Using ³²P-labeled undecaprenyl-pyrophosphate allows for highly sensitive detection of enzymatic activity. After the reaction, separate the products by thin-layer chromatography and quantify the dephosphorylated product using a phosphorimager or scintillation counting.

  • HPLC or LC-MS Analysis: These methods can directly quantify the conversion of substrate to product. Develop a chromatographic method that effectively separates undecaprenyl-pyrophosphate from undecaprenyl-phosphate, and monitor the appearance of the product over time.

For kinetic characterization, researchers should perform reactions with varying substrate concentrations (typically 1-100 μM) and measure initial reaction velocities to determine parameters such as Km and Vmax. Additionally, testing the effects of potential inhibitors, including bacitracin, can provide insights into the enzyme's mechanism and its role in antibiotic resistance.

To ensure reproducibility, controls should include heat-inactivated enzyme, reactions without enzyme, and reactions with known phosphatase inhibitors. When possible, commercially available phosphatases with similar substrate specificity can serve as positive controls for assay validation.

What methods can be used to study the role of uppP2 in bacitracin resistance?

Investigating the role of uppP2 in bacitracin resistance requires multiple complementary approaches that span from genetic manipulation to phenotypic characterization:

  • Gene Knockout and Complementation: Create a precise uppP2 knockout strain using CRISPR-Cas9 or homologous recombination methods. Measure changes in bacitracin minimum inhibitory concentration (MIC) compared to the wild-type strain. Complement the knockout with plasmid-expressed wild-type or mutant versions of uppP2 to confirm specificity and identify critical residues.

  • Expression Analysis under Bacitracin Stress: Use quantitative RT-PCR or RNA-Seq to measure changes in uppP2 expression levels when B. cereus is exposed to sub-inhibitory concentrations of bacitracin. This can reveal whether uppP2 is transcriptionally regulated in response to the antibiotic.

  • Biochemical Inhibition Studies: Test whether bacitracin directly affects uppP2 enzymatic activity in vitro using the assays described in section 3.1. This can help determine if bacitracin's mechanism includes direct inhibition of uppP2 or if the resistance mechanism is purely based on modifying bacitracin's target.

  • Membrane Lipid Analysis: Compare the levels of undecaprenyl-phosphate and undecaprenyl-pyrophosphate in wild-type and uppP2 knockout strains using chromatographic methods. This can verify whether uppP2 deletion leads to changes in the cellular pools of these lipid intermediates, especially under bacitracin stress.

  • Cell Wall Integrity Assays: Assess changes in cell wall integrity using fluorescent dyes (such as BODIPY-FL vancomycin), susceptibility to lysozyme, or electron microscopy to visualize cell wall alterations in uppP2 mutants compared to wild-type, particularly when exposed to bacitracin .

  • Genetic Association Studies: Analyze the correlation between uppP2 sequence variations across clinical or environmental isolates and their corresponding bacitracin resistance phenotypes to identify naturally occurring mutations that affect resistance levels.

By combining these methodological approaches, researchers can establish a comprehensive understanding of how uppP2 contributes to bacitracin resistance in B. cereus and potentially identify strategies to overcome this resistance mechanism.

How can the structure of uppP2 be determined and what insights might it provide?

Determining the three-dimensional structure of uppP2 requires a strategic combination of experimental and computational approaches:

  • X-ray Crystallography: The most direct approach involves producing highly purified, homogeneous uppP2 protein, screening for crystallization conditions, and collecting diffraction data at a synchrotron facility. For membrane-associated proteins like uppP2, detergent selection is critical; testing a panel of detergents (DDM, LDAO, C12E8) or using lipidic cubic phase crystallization may improve success rates. Adding specific ligands or inhibitors during crystallization can stabilize particular conformations.

  • Cryo-Electron Microscopy (cryo-EM): For proteins resistant to crystallization, cryo-EM offers an alternative approach. This technique may be particularly valuable if uppP2 forms higher-order complexes or if it can be visualized within its native membrane environment using nanodiscs or amphipols to maintain solubility.

  • NMR Spectroscopy: For specific domains or smaller fragments of uppP2, solution NMR can provide structural and dynamic information, especially for regions involved in substrate binding or catalysis.

  • Computational Modeling: When experimental structures prove challenging, homology modeling based on the 56% sequence identity with E. coli uppP can generate initial structural models . These can be refined using molecular dynamics simulations to predict conformational changes during catalysis.

The structural determination of uppP2 would provide several crucial insights:

  • Catalytic Mechanism: Identification of active site residues involved in undecaprenyl-pyrophosphate binding and hydrolysis.

  • Substrate Specificity: Structural features that differentiate uppP2 from other phosphatases like bcrC, despite their functional overlap.

  • Membrane Association: How uppP2 interacts with or is embedded within the bacterial membrane, providing access to its lipid substrate.

  • Potential Inhibition Sites: Druggable pockets that could be targeted for developing new antimicrobials against B. cereus.

  • Evolutionary Adaptations: Structural differences between uppP2 and homologs in other Bacillus species that might explain the specialized resistance mechanisms in the B. cereus group .

These structural insights would significantly advance our understanding of how uppP2 functions in bacitracin resistance and potentially inform strategies to overcome this resistance mechanism.

Which amino acid residues are critical for uppP2 enzymatic activity?

While the search results don't provide specific information about critical residues in B. cereus uppP2, a methodological approach to identify them would involve:

  • Sequence Alignment Analysis: Align uppP2 with homologous undecaprenyl-diphosphatases from various bacterial species, especially the E. coli homolog with which it shares 56% amino acid identity . Highly conserved residues across multiple species often indicate functional importance.

  • Structure-Guided Mutagenesis: Using either the experimental structure (if available) or homology models based on related structures, identify potential catalytic residues in the active site. These typically include:

    • Aspartic acid and glutamic acid residues that coordinate metal ions or participate in nucleophilic attack

    • Histidine residues that can act as acid-base catalysts

    • Lysine or arginine residues that might interact with phosphate groups

    • Serine or threonine residues that might be involved in substrate binding

  • Alanine Scanning Mutagenesis: Systematically replace candidate residues with alanine to assess their contribution to enzymatic activity. Measure the activity of each mutant using the assays described in section 3.1 to quantify changes in kinetic parameters (Km, kcat).

  • Targeted Functional Group Modifications: Beyond alanine substitutions, replace key residues with chemically similar but functionally distinct amino acids to probe specific aspects of their roles (e.g., replacing aspartate with asparagine to test the importance of negative charge).

  • Chemical Modification Studies: Use group-specific reagents (e.g., diethyl pyrocarbonate for histidines, carbodiimides for carboxyl groups) to chemically modify specific types of residues and correlate modifications with activity loss.

A typical data table from such analyses might resemble:

MutantRelative Activity (%)Km (μM)kcat (s⁻¹)kcat/Km (M⁻¹s⁻¹)Bacitracin MIC (μg/mL)
Wild-type10015.224.31.6×10⁶256
D37A<1ND*NDND8
H87A1268.42.84.1×10⁴32
R142A4547.311.22.4×10⁵128
S196A8322.620.18.9×10⁵192
E215A<1NDNDND8

*ND: Not detectable due to very low activity

Identifying critical residues would not only advance our understanding of uppP2's catalytic mechanism but could also guide the design of specific inhibitors that might resensitize B. cereus to bacitracin or other antimicrobials targeting the cell wall synthesis pathway.

How does uppP2 interact with the cell envelope biogenesis machinery in B. cereus?

Understanding the interactions between uppP2 and the cell envelope biogenesis machinery requires investigation of both physical protein-protein interactions and functional relationships:

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation (Co-IP) using antibodies against uppP2 followed by mass spectrometry can identify interacting proteins from the cell envelope synthesis pathway.

    • Bacterial two-hybrid systems can screen for specific binary interactions between uppP2 and candidate partners.

    • Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) can visualize interactions in living cells.

    • Cross-linking mass spectrometry can capture transient interactions between uppP2 and components of the cell wall synthesis machinery.

  • Subcellular Localization:

    • Fluorescent protein fusions (similar to the GerRB-SGFP2 approach used in B. cereus spore studies ) can reveal the spatial distribution of uppP2 in relation to cell wall synthesis complexes.

    • Immunogold electron microscopy can provide high-resolution localization data.

    • Super-resolution microscopy techniques like STORM or PALM can track uppP2 dynamics in living cells.

  • Functional Relationship Analysis:

    • Synthetic lethality or synthetic sickness phenotypes when uppP2 mutations are combined with mutations in other cell wall synthesis genes can indicate functional relationships.

    • Metabolic labeling of peptidoglycan precursors using fluorescent D-amino acids can track changes in cell wall synthesis dynamics when uppP2 is mutated or overexpressed.

    • Lipidomic analysis can measure changes in undecaprenyl-phosphate pools and their correlation with peptidoglycan synthesis rates.

The role of uppP2 likely extends beyond simple bacitracin resistance to fundamental aspects of cell envelope biogenesis. As demonstrated in studies of other B. cereus proteins like EntD, there is often a complex regulatory network linking cell wall structure, cell growth, motility, and various cellular functions . Understanding how uppP2 fits into this network could reveal new insights into bacterial cell biology and potential targets for antimicrobial development.

What is the relationship between uppP2 and bacterial pathogenesis?

The relationship between uppP2 and bacterial pathogenesis involves several potential mechanisms that researchers can investigate using the following methodological approaches:

  • Virulence in Infection Models:

    • Compare the virulence of wild-type B. cereus and uppP2 mutants in appropriate infection models (invertebrate, mammalian) to assess whether uppP2 contributes to pathogenicity.

    • Monitor bacterial loads, dissemination, and host survival rates to quantify differences in virulence.

    • Use in vivo competition assays between wild-type and uppP2 mutant strains to detect subtle fitness differences during infection.

  • Stress Resistance Profiling:

    • Test the impact of uppP2 deletion on resistance to host-derived antimicrobial peptides, oxidative stress, and other host defense mechanisms.

    • Assess growth and survival under conditions mimicking those encountered during infection (low pH, nutrient limitation, etc.).

    • Measure changes in cell wall properties that might affect bacterial persistence in the host environment.

  • Host-Pathogen Interaction Studies:

    • Examine the interaction of uppP2 mutants with host cells, including adhesion, invasion, and intracellular survival capabilities.

    • Assess host immune responses (cytokine production, inflammasome activation) to wild-type versus uppP2 mutant bacteria.

    • Investigate whether uppP2 activity indirectly affects the production or function of known virulence factors.

Based on research on other B. cereus proteins, such as EntD, there is evidence that cell wall-associated proteins can significantly impact virulence. For example, EntD has been shown to regulate cytotoxin production, with EntD-deficient strains showing reduced cytotoxicity against human Caco-2 cells . Similar studies could reveal whether uppP2 indirectly affects the expression or secretion of B. cereus enterotoxins and other virulence factors.

The relationship between uppP2 and pathogenesis may also extend to the closely related pathogen Bacillus anthracis, which shares many proteins with B. cereus . Understanding how uppP2 contributes to bacterial fitness in the host environment could provide insights into the pathogenesis mechanisms of both species and potentially identify new targets for antimicrobial intervention.

How can uppP2 be targeted for antimicrobial development?

Targeting uppP2 for antimicrobial development represents a promising strategy given its role in bacitracin resistance and cell envelope biogenesis. Researchers can pursue several methodological approaches:

  • Structure-Based Inhibitor Design:

    • Using crystallographic data or homology models of uppP2, perform virtual screening of compound libraries to identify molecules that bind to the active site.

    • Employ fragment-based drug discovery approaches, starting with small molecules that bind to different regions of the protein and linking them to create potent inhibitors.

    • Design transition state analogs that mimic the structure of undecaprenyl-pyrophosphate during the dephosphorylation reaction.

  • High-Throughput Screening:

    • Develop a fluorescence-based assay for uppP2 activity suitable for high-throughput format.

    • Screen diverse chemical libraries for compounds that inhibit uppP2 enzymatic activity.

    • Conduct secondary screens to confirm specificity and rule out promiscuous inhibitors.

  • Antimicrobial Adjuvant Development:

    • Test uppP2 inhibitors in combination with bacitracin to determine if they can resensitize resistant B. cereus strains.

    • Explore synergistic effects with other antibiotics targeting different steps in cell wall biosynthesis.

    • Optimize lead compounds for pharmacokinetic properties and reduced toxicity.

  • Target Validation:

    • Generate B. cereus strains with reduced uppP2 expression or activity-reducing mutations to confirm that targeting this enzyme leads to increased antibiotic susceptibility.

    • Use CRISPR interference to create an inducible uppP2 knockdown system for validating the target in vitro and potentially in vivo.

    • Assess whether clinical isolates with naturally occurring mutations in uppP2 show altered antibiotic susceptibility profiles.

  • Selectivity Assessment:

    • Compare uppP2 with human phosphatases to identify structural differences that can be exploited for selective inhibition.

    • Test lead compounds against human cell lines to assess cytotoxicity and potential off-target effects.

    • Evaluate activity against a panel of bacterial species to determine the spectrum of activity.

The development of uppP2 inhibitors could provide valuable new tools for combating antibiotic-resistant B. cereus infections, particularly in combination with existing antibiotics like bacitracin. This approach aligns with recent research suggesting that proteins like EntD and related Ent family proteins may provide attractive targets for studying and potentially treating both B. cereus and B. anthracis infections .

How do environmental factors influence uppP2 expression and activity?

Understanding how environmental factors influence uppP2 expression and activity is essential for comprehending B. cereus adaptation and resilience. Researchers can investigate this using several methodological approaches:

  • Transcriptional Regulation Analysis:

    • Perform quantitative RT-PCR to measure uppP2 mRNA levels under various conditions (different growth phases, nutrient limitations, antibiotic exposure, pH changes, temperature stress).

    • Construct reporter fusions (e.g., uppP2 promoter-GFP) to monitor transcriptional activity in real-time as environmental conditions change.

    • Use RNA-Seq to place uppP2 regulation within the context of global transcriptional responses to environmental stimuli.

    • Identify transcription factors that regulate uppP2 using chromatin immunoprecipitation (ChIP) or DNA affinity purification techniques.

  • Post-Transcriptional Regulation Studies:

    • Assess mRNA stability under different environmental conditions using transcription inhibition followed by time-course RT-PCR.

    • Investigate the role of small regulatory RNAs in modulating uppP2 expression using techniques like MAPS (MS2-affinity purification coupled with RNA sequencing).

    • Examine translational efficiency using ribosome profiling under various conditions.

  • Protein-Level Regulation:

    • Measure uppP2 protein levels using Western blotting with specific antibodies across different growth conditions.

    • Investigate post-translational modifications that might affect activity using mass spectrometry-based proteomics.

    • Assess protein stability and turnover rates using pulse-chase experiments with labeled amino acids.

  • Enzymatic Activity Modulation:

    • Develop assays to measure uppP2 activity in cell extracts or with purified enzyme under varying pH, temperature, ionic strength, and in the presence of potential physiological regulators.

    • Investigate allosteric regulation by metabolites that might signal cellular stress or nutrient availability.

    • Examine the impact of membrane lipid composition changes (which often occur in response to environmental stress) on uppP2 activity.

Research on other B. cereus proteins has shown that expression can vary significantly with growth phase. For example, the EntD gene showed highest expression during early exponential growth phase . Similar growth phase-dependent regulation might apply to uppP2, particularly if its function is most critical during active cell division and cell wall synthesis.

Understanding how environmental factors influence uppP2 could reveal how B. cereus modulates its resistance mechanisms in different ecological niches and during infection, potentially identifying conditions that increase susceptibility to antibiotics targeting cell wall synthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.