Recombinant Bacillus cereus UPF0059 membrane protein BC_5324 (BC_5324)

Shipped with Ice Packs
In Stock

Description

Protein Overview

BC_5324 is a 182-amino-acid membrane protein (UniProt ID: Q814U5) with the following features:

  • Gene Name: mntP

  • Synonyms: UPF0059 membrane protein BC_5324, Putative manganese efflux pump MntP

  • Source Organism: Bacillus cereus (strain ATCC 14579 / DSM 31)

  • Expression System: E. coli with N-terminal His-tag fusion for purification .

The protein’s amino acid sequence spans residues 1–182, with structural motifs indicative of membrane localization and potential ion transport activity.

Functional Role and Research Context

While BC_5324’s precise biological function remains under investigation, its annotation as a mntP homolog suggests a role in manganese efflux, a critical process for maintaining metal homeostasis in bacteria. Manganese efflux pumps are often linked to:

  • Metal Ion Regulation: Preventing toxic accumulation of divalent cations like Mn²⁺.

  • Stress Response: Surviving oxidative stress or environmental metal toxicity.

  • Pathogenicity: In Bacillus cereus, metal metabolism may influence virulence, though BC_5324’s direct role in pathogenicity is unconfirmed .

Research Relevance:
Membrane proteins like BC_5324 are integral to understanding bacterial physiology, particularly in spore-forming pathogens. Studies on Bacillus cereus membrane proteomes highlight their importance in:

  • Spore Germination: Inner membrane proteins facilitate nutrient uptake and environmental sensing .

  • Drug Target Identification: Membrane transporters account for ~60% of known drug targets, underscoring BC_5324’s potential as a therapeutic candidate .

Applications in Research

BC_5324 is utilized in:

  • Protein Structural Studies: His-tagged variants enable affinity chromatography and crystallization .

  • Functional Assays: Testing substrate specificity (e.g., manganese transport) or inhibitor binding.

  • Immunoassays: ELISA kits targeting BC_5324 are available for detecting anti-Bacillus cereus antibodies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific requirements for the format, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; BC_5324; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)
Target Names
mntP
Target Protein Sequence
MTFEQLIPLIIMAFALGMDAFSVSLGMGMMPLKLRQILYIGMTIGIFHIIMPFIGMVLGR FLSEKYGDIAHFAGAILLIGLGFYIVYSTILQNEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTIITILLFGFVSMLLAWIGLLIGRHAKDMLGTYGEIVGGIILVGFGLYILF PI
Uniprot No.

Target Background

Function
This protein is likely to function as a manganese efflux pump.
Database Links

KEGG: bce:BC5324

STRING: 226900.BC5324

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the transcriptional regulation of BC_5324 in Bacillus cereus?

Transcriptional regulation of membrane proteins like BC_5324 in Bacillus cereus appears to be environment-dependent. Studies comparing transcriptional profiles of B. cereus sensu lato strains in different atmospheric conditions (14% CO₂/bicarbonate versus ambient air) revealed that disease-causing Bacillus strains undergo more distinctive transcriptional changes between environments compared to avirulent strains . While BC_5324 specifically wasn't highlighted in these studies, the expression patterns of membrane proteins in B. cereus are likely influenced by both PlcR and AtxA transcriptional regulators, with each potentially acting in different environments . This suggests that optimal expression conditions for recombinant production should consider these regulatory factors.

What expression system is most effective for producing recombinant BC_5324?

For membrane proteins like BC_5324, E. coli remains the primary expression system due to its relative simplicity and widespread use in research laboratories . Selection of an appropriate E. coli strain is critical: while BL21(DE3) is commonly used, Origami strains may offer advantages due to their oxidizing cytoplasmic conditions that can benefit certain membrane proteins . For BC_5324 specifically, a comparative approach testing both strains would be advisable. Recent research has shown that tuning expression levels through CRISPR-based strategies creating libraries of bacterial hosts with variable ribosomal binding site sequences for T7 RNA polymerase can significantly improve yields of difficult-to-express proteins . This approach allows identification of the optimal translation rate for recombinant membrane proteins like BC_5324.

How can I optimize growth conditions to maximize BC_5324 expression?

Optimizing growth conditions requires understanding the native environment of B. cereus. Since transcriptional studies have shown significant differences in gene expression between CO₂-rich and ambient air environments , testing expression in both conditions may be beneficial. Recent advancements suggest that the timing of induction and growth temperature significantly impact membrane protein yields. For difficult membrane proteins like BC_5324, lower expression temperatures (20-25°C) often improve folding, though interestingly, some optimized expression systems perform better at 37°C than at 30°C, indicating that the standard assumption of lower temperatures being universally better may not always apply . A systematic approach testing different media compositions, induction times, and temperatures should be employed to determine optimal conditions.

What approaches can improve the solubility of recombinant BC_5324?

Improving the solubility of membrane proteins like BC_5324 requires strategic tag selection and fusion partner approaches. Recent innovations include:

  • Intrinsically Disordered Peptides (IDPs): The 53-amino acid NEXT tag isolated from marine bacterium Hydrogenovibrio marinus has shown superior performance compared to traditional MBP or GST tags in improving solubility of aggregation-prone proteins . IDPs work by exploiting their high degree of solvent exposure and elevated dynamics to exclude neighboring macromolecules, thereby preventing protein aggregation.

  • Synthetic IDPs (SynIDPs): These optimized sequences have been developed through screening large libraries to identify candidates particularly effective for aggregation-prone proteins . For membrane proteins like BC_5324, SynIDP-based constructs often provide higher yields than conventional fusion partners.

  • Environmental modification: Engineering host strains in which genes of the glutaredoxin pathway are deleted and the DNA sequence for thioredoxin B is fused to degradation tags can create tunable oxidizing/reducing conditions that benefit membrane protein folding .

For BC_5324 specifically, a comparative approach testing multiple solubility-enhancing strategies would be most effective, given the challenging nature of membrane protein expression.

What purification strategy yields the highest purity and activity for BC_5324?

The optimal purification strategy for BC_5324 should address its membrane-bound nature. Recent developments suggest a multi-step approach:

  • Affinity chromatography: Using the CASPON (CASPase-based fusiON) system, which comprises solubility-enhancing elements, a His tag, and a recognition site for efficient cleavage by circularly permuted caspase-2 . This has proven effective for increasing yields of various recombinant peptides expressed in E. coli.

  • Membrane protein extraction: Detergent selection is critical - mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) typically preserve membrane protein structure better than harsh ionic detergents.

  • Secondary purification: Size exclusion chromatography following affinity purification helps remove aggregates and improves homogeneity of the final protein preparation.

Activity assessment should be performed immediately after purification, as membrane proteins often exhibit reduced stability once extracted from their native lipid environment.

What structural analysis techniques are most informative for BC_5324?

Structural characterization of membrane proteins like BC_5324 requires complementary approaches:

  • Cryo-electron microscopy (cryo-EM): Increasingly the method of choice for membrane proteins as it doesn't require crystallization and can resolve structures in near-native states.

  • X-ray crystallography: Provides atomic resolution but requires stable crystal formation, which is challenging for membrane proteins. Lipidic cubic phase crystallization has improved success rates for membrane proteins.

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure content (α-helices vs. β-sheets) and can be used to assess proper folding.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Valuable for identifying solvent-exposed regions and conformational changes under different conditions.

For BC_5324 specifically, starting with CD spectroscopy to confirm proper folding before advancing to more resource-intensive techniques like cryo-EM would be a prudent approach.

How can I determine if recombinant BC_5324 is functionally active?

Since BC_5324 belongs to the UPF0059 family with uncharacterized function, assessing functional activity requires indirect approaches:

  • Binding assays: Using potential ligands identified through bioinformatic prediction or pull-down experiments from native B. cereus membranes.

  • Reconstitution experiments: Incorporating purified BC_5324 into liposomes or nanodiscs to assess whether it alters membrane properties or facilitates transport of specific molecules.

  • Comparative analysis: Testing the impact of BC_5324 expression on growth characteristics of B. cereus under different environmental conditions, especially comparing pathogenic and non-pathogenic strains .

  • Transcriptomic analysis: Examining how BC_5324 expression affects global gene expression patterns in B. cereus under different atmospheric conditions (CO₂-rich vs. ambient air), as environmental responsiveness has been linked to virulence regulation in the B. cereus group .

How can I evaluate the role of BC_5324 in B. cereus pathogenicity?

Investigating the potential role of BC_5324 in pathogenicity requires comparative approaches:

  • Gene deletion studies: Creating knockout strains and comparing virulence in appropriate infection models.

  • Transcriptional analysis: Comparing expression levels of BC_5324 between pathogenic and non-pathogenic B. cereus strains under various environmental conditions, particularly in CO₂-rich environments which have been shown to increase expression of plasmid-encoded virulence genes .

  • Regulatory network analysis: Examining interactions with known virulence regulators such as PlcR and AtxA, which have been shown to regulate gene expression in B. cereus G9241 in different environments .

  • Host cell interaction studies: Assessing whether BC_5324 affects bacterial adhesion, invasion, or survival within host cells.

The comparative transcriptional profiling approach used for B. cereus G9241 (pneumonia-causing), B. anthracis (Sterne 34F2, attenuated), and B. cereus 10987 (avirulent) provides a valuable framework for designing such studies .

What are the most common challenges in BC_5324 expression and how can they be addressed?

ChallengeSolution ApproachesImplementation Details
Low expression yieldsOptimized expression hostsUsing engineered CRISPR-based library of bacterial hosts with variable T7 RNA polymerase expression levels
Inclusion body formationFunctional aggregate strategyDesign three-component constructs with rigid proline/threonine linkers and C-terminal aggregation-inducing tags to obtain functionally active inclusion bodies
Improper foldingTunable redox environmentEngineer host strain with inducible oxidizing conditions, deleting glutaredoxin pathway genes and fusing thioredoxin B to degradation tags
Toxicity to host cellsExpression calibrationDevelop finely tunable control of T7 RNA polymerase using arabinose-based systems for precise modulation of expression levels
Low solubilityAdvanced fusion partnersEmploy synthetic intrinsically disordered peptides (SynIDPs) shown to rescue aggregation-prone proteins more effectively than conventional tags

How can I optimize BC_5324 for structural studies requiring isotopic labeling?

Optimizing isotopic labeling of membrane proteins like BC_5324 for NMR studies requires specialized approaches:

  • Selective labeling strategies: Focus on specific amino acids likely to be involved in function rather than attempting uniform labeling.

  • Modified minimal media: Recent advances in E. coli expression systems have developed specialized minimal media formulations that maintain high protein yields while allowing precise control of isotope incorporation.

  • Expression timing optimization: Since membrane proteins often exhibit toxicity when overexpressed, coordinating the timing of induction with growth phase is critical. Employing arabinose-controlled expression systems allows fine-tuning of expression levels to balance between adequate protein production and minimizing host cell stress .

  • Deuteration approaches: Partial deuteration can significantly improve NMR spectral quality for membrane proteins, though optimal deuteration levels need to be empirically determined.

  • Chaperone co-expression: For challenging membrane proteins, co-expressing molecular chaperones can improve folding efficiency while maintaining incorporation of isotopic labels.

What are the emerging technologies that could advance BC_5324 research?

Several cutting-edge approaches show promise for advancing research on membrane proteins like BC_5324:

  • AlphaFold and structure prediction: Deep learning approaches are increasingly capable of predicting membrane protein structures with high accuracy, providing valuable starting points for functional hypotheses.

  • Nanobody development: The production of nanobodies against membrane proteins has been revolutionized by switchable systems that exploit phosphate depletion to trigger transitions from reducing to oxidizing cytoplasm, yielding unprecedented amounts (100-800 mg/L in shake flasks, >2 g/L in bioreactors) of functional nanobodies .

  • Synthetic biology approaches: Protein Glycan Coupling Technology (PGCT) allows in vivo coupling of recombinant glycan antigens to carrier proteins, which could be valuable for studying membrane protein interactions .

  • Cell-free expression systems: Emerging cell-free systems specialized for membrane proteins circumvent toxicity issues and allow direct incorporation into nanodiscs or liposomes.

  • Cryo-electron tomography: This technique enables visualization of membrane proteins in their native cellular context, providing insights into localization and complex formation that are impossible with purified proteins.

While the function of BC_5324 remains to be fully elucidated, these approaches provide powerful tools to advance our understanding of this uncharacterized membrane protein and its potential role in B. cereus biology and pathogenicity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.