Recombinant Bacillus cereus UPF0059 membrane protein BCA_5473 (BCA_5473)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bacillus cereus UPF0059 Membrane Protein BCA_5473 (BCA_5473)

Recombinant Bacillus cereus UPF0059 membrane protein BCA_5473 is a purified, recombinant protein derived from Bacillus cereus (strain unspecified in sources but linked to the BCA_5473 locus). It is expressed in Escherichia coli and fused with an N-terminal histidine (His) tag for easy purification . This protein is part of the UPF0059 family, a group of uncharacterized membrane-associated proteins found in gram-positive bacteria .

Expression system:

  • Host organism: E. coli .

  • Construct: Full-length BCA_5473 (1–182 aa) fused to an N-terminal His-tag for affinity purification via nickel-chelating chromatography .

Purification and quality control:

  • Purity: >90% confirmed via SDS-PAGE .

  • Storage buffer: Tris-based buffer with 50% glycerol, optimized for stability .

Applications in research:

  • Structural studies: Recombinant BCA_5473 may be used for crystallization or cryo-EM to resolve its 3D structure .

  • ELISA assays: Recombinant UPF0059 proteins (e.g., BCG9842_B5505) serve as antigens for antibody production .

Functional Role in Bacillus cereus Membrane Proteome

Membrane proteome context:

  • B. cereus vegetative cells and spores exhibit distinct membrane protein repertoires. Vegetative cells prioritize transporters, receptors, and motility-related proteins, while spores rely on germinant receptors and stress-response proteins .

  • BCA_5473 is classified among 498 vegetative cell membrane proteins identified via quantitative proteomics .

Hypothesized functions:

  • Transport: Potential role in nutrient uptake or ion exchange .

  • Signaling: Membrane localization suggests involvement in sensory or regulatory pathways .

  • Structural support: May stabilize membrane integrity under stress .

Research Applications and Challenges

Experimental uses:

  1. Toxin interaction studies: Investigating potential interactions with B. cereus enterotoxins (e.g., Hbl, Nhe) .

  2. Membrane dynamics: Probing lipid-protein interactions in B. cereus membranes .

  3. Antibody development: Scaffolding for anti-UPF0059 antibodies for diagnostic assays .

Limitations:

  • Functional ambiguity: No direct evidence links BCA_5473 to pathogenicity or core metabolic processes .

  • Strain variability: UPF0059 proteins exhibit sequence divergence across B. cereus strains, complicating functional generalization .

Table 2: Comparative Analysis of UPF0059 Proteins

FeatureBCA_5473 (C1F0Q1)BCG9842_B5505 (B7IQX7)
StrainB. cereus (unspecified)B. cereus G9842
Gene LocusBCA_5473BCG9842_B5505
ApplicationsStructural studiesELISA, antibody production
TagHis-tagUndetermined

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; BCA_5473; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus cereus (strain 03BB102)
Target Names
mntP
Target Protein Sequence
MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALKIRQILYIGVTIGIFHIIMPFIGMVLGR FLSEQYGDIAHFAGAILLIGLGFYIVYSSILENEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTIITILLFGFVSMLLAWIGLLIGRHAKGMLGTYGEIVGGIILVGFGLYLLF PI
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links

KEGG: bcx:BCA_5473

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus cereus and why is it significant for membrane protein research?

Bacillus cereus is a Gram-positive, spore-forming, rod-shaped bacterium belonging to the Bacillus cereus group within the phylum Firmicutes. This group includes several closely related species with pathogenic potential, including B. anthracis, B. cereus, and B. thuringiensis . B. cereus is significant for membrane protein research because it represents a model organism for studying bacterial membrane architecture and function in both vegetative cells and dormant spores. As a food-borne pathogen that produces toxins causing diarrheal and emetic syndromes, understanding its membrane proteins can provide insights into bacterial survival mechanisms and potential therapeutic targets .

Methodologically, researchers studying B. cereus membrane proteins typically employ comparative genomics approaches to identify conserved membrane proteins across the Bacillus genus, followed by structural and functional characterization using techniques like membrane protein enrichment, quantitative proteomics, and bioinformatics filtering to identify specific membrane-associated proteins .

What is known about the function of UPF0059 family membrane proteins in bacteria?

The UPF0059 family (Uncharacterized Protein Family 0059) includes membrane proteins that are widely conserved across bacterial species but whose functions remain largely uncharacterized. Based on the membrane proteome studies of B. cereus, these proteins likely play roles in essential cellular processes.

While specific information about BCA_5473 is limited in the search results, membrane proteins in B. cereus vegetative cells generally participate in diverse functions including transport, signal transduction, and cell division . Research methodology for characterizing such proteins typically begins with bioinformatic analysis to predict transmembrane domains, followed by heterologous expression systems to produce recombinant protein for functional studies.

How does BCA_5473 compare to other membrane proteins in the Bacillus cereus group?

The Bacillus cereus group includes several species with closely related phylogeny and genomic structures. Membrane proteome studies have identified significant differences between vegetative cells and spores, with 498 vegetative cell membrane proteins and 244 spore inner membrane proteins identified in B. cereus .

To compare BCA_5473 with other membrane proteins, researchers typically employ sequence alignment tools to identify conserved domains, phylogenetic analysis to determine evolutionary relationships, and comparative structural modeling to predict functional similarities. Quantitative proteomics approaches can also determine relative expression levels across different growth conditions or life stages.

The research has shown that the cell membrane proteome of B. cereus has a higher number of transporters, receptors, and proteins related to cell division and motility compared to the spore inner membrane . Understanding where BCA_5473 fits into this spectrum requires experimental determination of its expression patterns across different growth phases.

What are the best methods for expressing and purifying recombinant BCA_5473?

Expressing and purifying membrane proteins presents particular challenges due to their hydrophobic nature and requirement for a lipid environment. For recombinant BCA_5473, a methodological approach would include:

This methodological approach draws from established techniques for membrane protein purification while addressing the specific challenges of UPF0059 family proteins.

How can researchers effectively study the membrane localization of BCA_5473?

Studying membrane localization requires methodological approaches that preserve native cellular architecture while providing specific detection. Recommended methods include:

  • Fluorescent protein fusion: Creating GFP/mCherry fusions with BCA_5473 for live-cell imaging, ensuring the fusion does not interfere with localization signals.

  • Immunolocalization: Developing specific antibodies against BCA_5473 or its tags for immunofluorescence or immunoelectron microscopy, providing higher resolution imaging.

  • Membrane fractionation: Differential centrifugation and density gradient techniques to separate different cellular compartments, followed by Western blotting to track the protein distribution.

  • Protease accessibility assays: Limited proteolysis of intact cells, spheroplasts, or membrane vesicles to determine the topology of BCA_5473 within the membrane.

For B. cereus specifically, researchers have successfully used membrane enrichment methods coupled with quantitative proteomics to study membrane proteins in both vegetative cells and spores . This approach can be adapted specifically for BCA_5473 localization studies.

What experimental controls are essential when studying BCA_5473 function?

  • Negative controls: Include empty vector transformants, inactive mutants, or closely related but functionally distinct membrane proteins.

  • Positive controls: Well-characterized membrane proteins from the same family or with predicted similar functions.

  • Expression level controls: Quantification of expression levels to ensure phenotypic differences are not due to variable expression.

  • Complementation controls: Verification that wild-type BCA_5473 can restore function in knockout mutants.

  • Non-specific effect controls: Controls to distinguish protein-specific effects from general membrane perturbation (e.g., detergent controls in reconstitution experiments).

When studying potential roles in pathogenesis, comparisons with other B. cereus virulence factors like Hemolysin BL (HBL) can provide valuable context . Experiments should discriminate between direct effects of BCA_5473 and indirect effects mediated through other cellular processes.

What role might BCA_5473 play in Bacillus cereus pathogenicity?

While specific information about BCA_5473's role in pathogenicity is not directly provided in the search results, we can consider methodological approaches to investigate this question based on known B. cereus virulence mechanisms.

B. cereus pathogenicity involves multiple toxins and virulence factors, including the tripartite hemolysin BL (HBL) toxin that forms membrane pores and activates the NLRP3 inflammasome . To investigate BCA_5473's potential role in pathogenicity, researchers should:

  • Generate knockout mutants: Create BCA_5473 deletion strains and assess changes in virulence using in vitro cell infection models and in vivo infection models.

  • Transcriptional analysis: Compare BCA_5473 expression between virulent and avirulent strains, and under conditions that induce virulence factor expression.

  • Interaction studies: Investigate potential interactions between BCA_5473 and known virulence factors using co-immunoprecipitation, bacterial two-hybrid systems, or proximity labeling approaches.

  • Host response assessment: Measure inflammatory responses (cytokine production, inflammasome activation) in response to purified BCA_5473 or BCA_5473-expressing strains versus knockout controls.

Experimental ApproachAdvantagesLimitationsKey Measurements
Knockout studiesDirect assessment of functionPotential compensation by other genesVirulence phenotypes, toxin production
Expression analysisCorrelation with virulence conditionsCorrelative rather than causativeTranscription/protein levels during infection
Interaction studiesIdentifies molecular mechanismsIn vitro interactions may not reflect in vivoProtein-protein interactions, complex formation
Host response studiesDirect measure of pathogenicityMay miss non-inflammatory virulence mechanismsCytokine levels, cell death, inflammasome activation

How does BCA_5473 expression differ between vegetative cells and spores of B. cereus?

Understanding differential expression patterns between vegetative cells and spores is crucial for elucidating protein function in different life stages of B. cereus. Research has shown significant differences in membrane proteome composition between these states .

Methodological approaches to investigate BCA_5473 expression differences should include:

  • Quantitative proteomics: Using techniques like LC-MS/MS to compare protein abundance in vegetative cell membranes versus spore inner membranes.

  • Transcriptional analysis: Employing RT-qPCR or RNA-seq to analyze BCA_5473 transcript levels during vegetative growth versus sporulation.

  • Reporter gene fusions: Creating promoter-reporter fusions to visualize expression patterns in real-time during growth and sporulation.

  • Immunodetection: Using specific antibodies to track protein levels in different cellular states and under various environmental conditions.

Research has demonstrated that the spore inner membrane has a distinct proteome compared to vegetative cells, with different transporters and receptors . For instance, the spore membrane shows a preference for simple carbohydrate transporters (glucose and fructose) and contains specific germinant receptors . Determining where BCA_5473 fits within this expression pattern would provide valuable functional insights.

What protein-protein interactions might BCA_5473 participate in?

Membrane proteins often function within complexes or interact with other cellular components. For BCA_5473, potential interaction partners could include:

  • Other membrane proteins: Particularly those involved in similar cellular processes or co-expressed under similar conditions.

  • Cytosolic proteins: Those that might interact with cytoplasmic domains of BCA_5473 for signaling or regulatory purposes.

  • Cell wall components: If BCA_5473 has domains extending into the cell wall, interactions with peptidoglycan or teichoic acids.

Methodological approaches to identify these interactions include:

  • Affinity purification coupled with mass spectrometry: Using tagged BCA_5473 to pull down interaction partners.

  • Bacterial two-hybrid or split-protein complementation assays: For in vivo detection of specific protein-protein interactions.

  • Chemical cross-linking: To capture transient interactions followed by mass spectrometry identification.

  • FRET or BRET analysis: For investigating interactions in live cells with minimal disruption.

When interpreting results, researchers should consider that the tripartite nature of some B. cereus toxins, like HBL, demonstrates that sequential binding and complex formation can be critical to function . Therefore, temporal aspects of interactions should be considered alongside spatial co-localization.

What structural characteristics might define the function of BCA_5473?

Understanding the structural characteristics of BCA_5473 is essential for elucidating its function. Advanced methodological approaches include:

  • Structural prediction: Using AlphaFold2 or RoseTTAFold to generate structural models based on amino acid sequence.

  • Experimental structure determination: X-ray crystallography of purified protein in detergent micelles or lipidic cubic phase, cryo-electron microscopy for larger complexes, or NMR for dynamic structure analysis.

  • Structure-function analysis: Site-directed mutagenesis targeting predicted functional residues based on structural models, followed by functional assays.

  • Molecular dynamics simulations: To understand protein behavior within a lipid bilayer environment and predict conformational changes.

The UPF0059 family likely contains specific conserved structural elements that define its function. Research on other membrane proteins in B. cereus has shown that structural characteristics can be linked to specific functions; for example, the pore-forming ability of HBL toxin components relates directly to their tertiary structure .

How might post-translational modifications affect BCA_5473 function?

Post-translational modifications (PTMs) can significantly alter membrane protein function, localization, and interactions. For BCA_5473, potential PTMs to investigate include:

  • Phosphorylation: Often involved in signaling cascades and protein activity regulation.

  • Lipidation: Addition of lipid moieties that could affect membrane anchoring or protein-protein interactions.

  • Glycosylation: Though less common in bacteria than eukaryotes, some bacterial membrane proteins undergo glycosylation.

Methodological approaches for PTM investigation include:

  • Mass spectrometry-based proteomics: Targeted approaches to identify specific modifications.

  • Site-directed mutagenesis: Mutating potential modification sites to assess functional consequences.

  • Specific antibodies: Developing antibodies that recognize modified forms of BCA_5473.

  • In vitro modification assays: Reconstituting modification systems to study their effects on purified BCA_5473.

The search results don't provide specific information about PTMs in B. cereus membrane proteins, but research into bacterial membrane proteins generally has shown that PTMs can be critical for adaptation to environmental conditions and host interactions.

How can advanced imaging techniques advance our understanding of BCA_5473 dynamics?

Advanced imaging techniques provide powerful tools for understanding membrane protein behavior in living cells. For BCA_5473, methodological approaches include:

  • Super-resolution microscopy: Techniques like STORM, PALM, or STED to visualize protein distribution below the diffraction limit.

  • Single-molecule tracking: Following individual fluorescently labeled BCA_5473 molecules to determine mobility, clustering, and interactions.

  • FRAP (Fluorescence Recovery After Photobleaching): To measure protein diffusion rates within the membrane.

  • Correlative light and electron microscopy (CLEM): Combining fluorescence localization with ultrastructural context.

These techniques can reveal dynamic aspects of BCA_5473 function that static structural studies cannot capture. For instance, they could help determine whether BCA_5473 forms clusters, localizes to specific membrane domains, or changes distribution during the cell cycle or under stress conditions.

What are common difficulties in expressing recombinant UPF0059 family membrane proteins?

Membrane protein expression presents significant challenges, particularly for poorly characterized families like UPF0059. Common difficulties include:

  • Toxicity to expression hosts: Overexpression can disrupt membrane integrity or overwhelm insertion machinery.

  • Misfolding and aggregation: Improper folding leading to inclusion body formation.

  • Low yield: Insufficient protein production for downstream applications.

  • Instability: Rapid degradation of expressed protein.

Troubleshooting approaches include:

  • Expression optimization: Testing different promoters, induction conditions, and growth temperatures to balance expression with proper folding.

  • Host strain selection: Using specialized strains with enhanced membrane protein expression capabilities.

  • Fusion partners: Incorporating solubility-enhancing tags or fusion partners.

  • Co-expression strategies: Expressing chaperones or other folding factors alongside the target protein.

Researchers have successfully adapted membrane enrichment methods for studying B. cereus membrane proteins , suggesting that with proper optimization, recombinant BCA_5473 expression is achievable.

How can researchers address the challenge of functional redundancy when studying BCA_5473?

Functional redundancy in bacterial systems often complicates the interpretation of single-gene studies. Methodological approaches to address this challenge include:

  • Multiple gene deletions: Creating strains with deletions in BCA_5473 and functionally related genes.

  • Conditional expression systems: Using inducible promoters to control expression levels and timing.

  • Domain swapping experiments: Exchanging domains between BCA_5473 and related proteins to identify specific functional modules.

  • Heterologous expression: Expressing BCA_5473 in different bacterial species that lack similar proteins.

  • Synergistic phenotype analysis: Looking for conditions where subtle phenotypes of single mutants are amplified in combination.

This challenge is particularly relevant given the high genetic similarity within the B. cereus group . Complementation studies using recombinant BCA_5473 in knockout strains provide the most direct evidence of function while controlling for potential compensatory mechanisms.

What considerations are important when designing functional assays for BCA_5473?

Designing functional assays for an uncharacterized membrane protein requires careful consideration of potential roles based on sequence features, expression patterns, and cellular context. Important considerations include:

  • Physiological relevance: Assays should reflect conditions where BCA_5473 is naturally expressed.

  • Sensitivity: The ability to detect subtle phenotypic changes that might result from single gene manipulation.

  • Specificity: Controls to distinguish direct effects of BCA_5473 from indirect consequences of membrane perturbation.

  • Scalability: Capacity for high-throughput screening of conditions or mutants.

  • Integration with cellular context: Considering potential interactions with other cellular components.

Based on what is known about B. cereus membrane proteins , functional assays might focus on transport capabilities, stress responses, spore formation and germination, or potential contributions to virulence. Comparisons between expression in vegetative cells versus spores could provide important clues to function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.