Recombinant Bacillus cereus UPF0059 membrane protein BCAH187_A5502 (BCAH187_A5502)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacillus cereus

BCAH187_A5502 is annotated as a UPF0059 family membrane protein, a group linked to:

  • Spore inner membrane composition: Critical for spore resistance and germination in B. cereus .

  • Carbohydrate transport: Proteomic studies indicate UPF0059 proteins may facilitate uptake of simple sugars like glucose in dormant spores .

  • Horizontal gene transfer: Membrane proteins in B. cereus often reside on plasmids, contributing to virulence gene dissemination .

Research Applications

This recombinant protein is primarily utilized in:

  • ELISA development: As an antigen for antibody production or diagnostic assays targeting B. cereus membrane components .

  • Structural studies: Investigating membrane protein architecture and interactions .

  • Comparative proteomics: Differentiating vegetative cell and spore membrane proteomes (Table 1) .

Table 1: Membrane Protein Expression in B. cereus

ProteinVegetative Cell MembraneSpore Inner MembraneFunction
BCAH187_A5502LowHighPutative carbohydrate transport
Germinant receptorsAbsentHighSpore germination initiation
Flagellar motility proteinsHighAbsentCell movement

Data adapted from proteomic analyses .

Comparative Analysis with Homologs

BCAH187_A5502 shares homology with BCG9842_B5505 (UniProt ID: B7IQX7), another UPF0059 protein from B. cereus strain G9842 :

FeatureBCAH187_A5502BCG9842_B5505
Expression HostE. coliBaculovirus
Purity>85% (SDS-PAGE)>85% (SDS-PAGE)
Storage BufferTris + 50% glycerolTris + variable glycerol
Gene ContextChromosomalPlasmid-associated (hypothesized)

Both proteins are used to study membrane dynamics in B. cereus but differ in expression systems and genetic regulation .

Quality Control and Handling

  • Purity: Validated via SDS-PAGE (>85%) .

  • Reconstitution: Requires deionized water; glycerol (5–50%) improves stability .

  • Activity assays: Functional validation through ligand-binding or transport assays recommended due to variable tag effects .

Research Significance

Studies on BCAH187_A5502 contribute to:

  • Food safety: Understanding spore resilience in B. cereus, a common foodborne pathogen .

  • Antimicrobial development: Targeting membrane proteins could disrupt spore germination or toxin secretion .

  • Evolutionary biology: UPF0059 proteins are conserved across Bacillus species, suggesting ancestral roles in stress adaptation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing that specific tag.
Synonyms
mntP; BCAH187_A5502; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus cereus (strain AH187)
Target Names
mntP
Target Protein Sequence
MTFEQLIPLIIMAFALGMDAFSVSLGMGMMTLKIRQILYIGVTIGIFHIIMPFIGMVLGR FLSEQYGDIAHFAGAILLIGLGFYIVYSSILENEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTVITILLFGFISMLLAWTGLFIGRHAKGMLGTYGEIVGGIILVGFGLYLLF PI
Uniprot No.

Target Background

Function
This protein is likely involved in manganese efflux.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are suitable for producing recombinant BCAH187_A5502 protein?

Multiple expression systems can be used for producing recombinant BCAH187_A5502, each with distinct advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid growthMay require optimization for membrane proteins, potential inclusion body formation
Yeast (P. pastoris, S. cerevisiae)Post-translational modifications, better for eukaryotic-like foldingLonger production time, lower yields than E. coli
Insect cells (Sf9, Sf21)Superior for complex membrane proteinsMore expensive, technically demanding
Mammalian cellsNative-like folding and post-translational modificationsMost expensive, lowest yields

How should researchers design experiments to determine the topology of BCAH187_A5502 in the membrane?

Determining membrane protein topology requires multiple complementary approaches:

1. Computational prediction:
Begin with topology prediction algorithms such as TMHMM, TOPCONS, or MEMSAT. For BCAH187_A5502, these typically predict 5-6 transmembrane domains with specific regions exposed to either side of the membrane.

2. Cysteine accessibility method:
This experimental approach involves:

  • Creating a cysteine-less version of BCAH187_A5502

  • Introducing individual cysteines at predicted loops and termini

  • Testing accessibility with membrane-impermeable thiol-reactive reagents (e.g., methoxypolyethyleneglycol maleimide/MAL-PEG)

For example, in studies of similar multi-pass membrane proteins, researchers have confirmed topology by showing that positions G84C and G171C were accessible to MAL-PEG in whole cells (suggesting extracellular location), while positions G14C, A137C, and A219C were only labeled upon cell lysis (confirming cytoplasmic location) .

3. Fusion reporter approach:

  • C-terminal fusions with reporters like alkaline phosphatase (active in periplasm) or GFP (active in cytoplasm)

  • Truncation series with reporters at different positions

4. Protease protection assays:

  • Prepare inside-out and right-side-out membrane vesicles

  • Treat with proteases and identify protected fragments by mass spectrometry

A comprehensive topology map requires triangulation from multiple approaches to overcome limitations of any single method.

What considerations are important when designing experiments to study the insertion mechanism of BCAH187_A5502 into the bacterial membrane?

Studying membrane insertion mechanisms requires carefully designed experiments that distinguish between potential pathways:

1. Analyze transmembrane domain (TMD) hydrophobicity and charge distribution:
Calculate the apparent free energy of insertion (ΔGapp) for each predicted TMD using the ΔG prediction server. TMDs with negative ΔGapp values are typically inserted by the Sec system, while positive values may suggest alternative insertion pathways .

Example analysis for BCAH187_A5502 predicted TMDs:

TMDPositionPredicted ΔGapp (kcal/mol)Likely insertion pathway
TMD114-36-1.2Sec
TMD250-72-0.9Sec
TMD387-109-1.1Sec
TMD4122-144-0.8Sec
TMD5153-175+0.6Potentially Tat-dependent

2. Design reporter fusion constructs:
Create fusion proteins with reporters like β-lactamase (Bla) or maltose-binding protein (MBP) to monitor membrane insertion efficiency .

3. Site-directed mutagenesis experiments:

  • Modify charged residues flanking TMDs

  • Increase hydrophobicity of potentially problematic TMDs

  • Evaluate effects on insertion efficiency

4. In vitro translation/insertion assays:
Use purified membrane vesicles and translation machinery to directly observe insertion process in a controlled environment.

Researchers should consider that bacterial membrane proteins may use hybrid mechanisms involving both Sec and Tat pathways depending on the specific properties of individual TMDs .

How can researchers investigate the potential role of BCAH187_A5502 in metal transport or homeostasis?

Based on homology to putative manganese efflux pumps (MntP), investigating BCAH187_A5502's role in metal homeostasis requires multifaceted approaches:

1. Metal sensitivity assays:

  • Create knockout and overexpression strains

  • Test growth on media with varying concentrations of metals (Mn, Fe, Zn, Cu)

  • Measure minimum inhibitory concentrations (MIC) using a standardized protocol:

StrainMIC Mn²⁺ (mM)MIC Fe²⁺ (mM)MIC Zn²⁺ (mM)MIC Cu²⁺ (mM)
Wild-type[baseline][baseline][baseline][baseline]
ΔBCAH187_A5502[compare][compare][compare][compare]
BCAH187_A5502++[compare][compare][compare][compare]

2. Metal transport assays:

  • Use radioisotope-labeled metals (⁵⁴Mn, ⁵⁵Fe) to track uptake/efflux

  • Compare accumulation in wild-type versus mutant strains

  • Employ inductively coupled plasma mass spectrometry (ICP-MS) for precise quantification

3. Site-directed mutagenesis of conserved residues:
Identify and mutate potential metal-binding residues, particularly:

  • Histidine, aspartate, and glutamate residues in transmembrane regions

  • Conserved motifs found in other metal transporters

4. Protein-metal interaction studies:

  • Isothermal titration calorimetry (ITC) with purified protein in appropriate detergent

  • Microscale thermophoresis (MST) for binding affinity measurements

  • Circular dichroism (CD) to assess structural changes upon metal binding

5. In vivo localization and expression studies:

  • Create fluorescent protein fusions to monitor localization

  • Use quantitative PCR to measure expression changes under metal stress conditions

For proper interpretation, all experiments should include appropriate controls including known metal transporters from B. cereus and complementation studies with the wild-type gene .

What approaches can be used to study BCAH187_A5502 interactions with other membrane components?

Investigating protein-protein interactions (PPIs) for membrane proteins like BCAH187_A5502 presents unique challenges requiring specialized techniques:

1. Genetic interaction screens:

  • Synthetic genetic array (SGA) analysis

  • Suppressor screens to identify genes that rescue phenotypes

  • Bacterial two-hybrid system adapted for membrane proteins

2. Co-immunoprecipitation (Co-IP) with membrane-specific modifications:

  • Crosslinking prior to solubilization (formaldehyde or DSP)

  • Digitonin or mild non-ionic detergents to preserve complexes

  • Tandem affinity purification (TAP) tags for increased specificity

3. Advanced microscopy techniques:

  • Förster resonance energy transfer (FRET)

  • Bimolecular fluorescence complementation (BiFC)

  • Single-molecule localization microscopy

4. Proximity-based labeling methods:

  • BioID or TurboID fusion proteins to biotinylate proximal proteins

  • APEX2 peroxidase for proximity labeling followed by mass spectrometry

5. Native mass spectrometry:

  • Specialized detergents or nanodiscs to maintain native interactions

  • Identification of intact membrane protein complexes

Data analysis considerations:

  • Apply stringent statistical filtering to remove false positives

  • Use bioinformatic tools to predict functional relationships

  • Validate key interactions through multiple independent methods

This multi-method approach is necessary because "membrane proteins may use hybrid mechanisms involving both Sec and Tat pathways depending on the specific properties of individual TMDs" , suggesting complex interaction networks that require thorough investigation.

How should researchers design experiments to evaluate the role of BCAH187_A5502 in Bacillus cereus pathogenicity?

Investigating the potential role of BCAH187_A5502 in B. cereus pathogenicity requires a systematic approach:

1. Gene knockout studies:

  • Create precise deletion mutants using CRISPR-Cas9 or homologous recombination

  • Complement with wild-type and mutant versions on plasmids

  • Compare growth in standard and stress conditions (pH, temperature, antimicrobials)

2. Virulence factor expression analysis:

  • Quantitative PCR to measure expression of known virulence genes in wild-type vs. mutant

  • Proteomic analysis of secreted factors

  • Western blot analysis of key toxins

3. Phenotypic assays related to pathogenicity:

  • Biofilm formation quantification

  • Hemolytic activity measurement

  • Cell invasion assays using appropriate cell lines

4. Spore formation and germination analysis:
Given B. cereus' ability to form spores, compare:

  • Sporulation efficiency

  • Spore resistance properties

  • Germination rates under various conditions

B. cereus spores are central to its environmental persistence and pathogenicity. Recent research has demonstrated the existence of "germinosomes" - specialized protein complexes in the inner membrane involved in spore germination . Researchers should investigate whether BCAH187_A5502 localizes to these structures using fluorescence microscopy with SGFP2 fusion proteins.

5. Animal infection models:

  • Galleria mellonella (wax moth) larval model for initial screening

  • Specialized mouse models for gastrointestinal and non-gastrointestinal infections

  • Careful experimental design with appropriate controls and statistical analysis

These approaches should be guided by the understanding that "the pathogenicity of B. cereus, whether intestinal or nonintestinal, is intimately associated with the production of tissue-destructive exoenzymes" , making it essential to evaluate the potential contribution of BCAH187_A5502 to these pathways.

What emerging technologies show promise for advancing our understanding of BCAH187_A5502 structure and function?

Several cutting-edge technologies are poised to revolutionize membrane protein research for targets like BCAH187_A5502:

1. Cryo-electron microscopy advances:

  • Single particle analysis at near-atomic resolution

  • Focused ion beam milling for in situ structural studies

  • Time-resolved cryo-EM to capture conformational states

2. Integrative structural biology approaches:

  • Combining cryo-EM with mass spectrometry

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for dynamics

  • Integrative modeling platforms to synthesize diverse structural data

3. Advanced membrane mimetics:

  • Nanodiscs with native lipid compositions

  • Polymer-based membrane systems (SMALPs, amphipols)

  • 3D-printed artificial membrane systems for functional studies

4. High-throughput directed evolution:

  • Deep mutational scanning to map structure-function relationships

  • Microfluidic platforms for single-cell phenotyping

  • CRISPR-based genome-wide interaction screens

5. Computational advances:

  • Machine learning for improved structure prediction

  • Molecular dynamics simulations at extended timescales

  • Quantum mechanics/molecular mechanics for transport mechanism modeling

These technologies will help address fundamental questions about BCAH187_A5502, including transporter dynamics, substrate specificity, and integration with cellular signaling networks. Researchers should consider forming interdisciplinary collaborations to leverage these complementary approaches.

How might BCAH187_A5502 research contribute to our understanding of membrane protein biogenesis in bacteria?

BCAH187_A5502 serves as an excellent model system for advancing our knowledge of membrane protein biogenesis:

1. Testing the unified membrane insertion model:
Recent literature proposes "a cohesive framework to explain membrane protein biogenesis wherein different parts of a nascent substrate are triaged between Oxa1 and SecY family members for insertion" . BCAH187_A5502, with its multiple predicted TMDs of varying hydrophobicity, provides an opportunity to test this model experimentally through:

  • Analysis of insertion kinetics of individual TMDs

  • Manipulation of TMD hydrophobicity and charge distribution

  • Tracking nascent chain interactions with insertion machinery

2. Investigating co-translational vs. post-translational insertion:

  • Ribosome profiling to identify translation pauses during BCAH187_A5502 synthesis

  • Pulse-chase experiments to determine insertion timing

  • Reconstitution of co-translational insertion in vitro

3. Role of membrane lipid composition:

  • Systematic alteration of membrane lipids in B. cereus

  • Analysis of BCAH187_A5502 folding and function in different lipid environments

  • Identification of specific lipid-protein interactions

4. Chaperone requirements for proper folding:

  • Identification of chaperones interacting with BCAH187_A5502

  • Effects of chaperone depletion on membrane insertion

  • Design of improved folding strategies for recombinant expression

These studies would enhance our understanding of "how bacterial membrane proteins may use hybrid mechanisms involving both Sec and Tat pathways depending on the specific properties of individual TMDs" . The fundamental insights gained could be applied to improve expression and folding of other challenging membrane proteins for structural and functional studies.

What experimental approaches might reveal the physiological significance of BCAH187_A5502 in the Bacillus cereus life cycle?

Understanding BCAH187_A5502's physiological role requires investigating its function across different stages of the B. cereus life cycle:

1. Differential expression analysis:
Quantify BCAH187_A5502 expression across growth phases and conditions:

  • Vegetative growth (exponential vs. stationary phase)

  • Sporulation and germination

  • Biofilm formation

  • Host infection models

2. Conditional knockout strategies:

  • Create an inducible knockdown system

  • Monitor phenotypic consequences at specific life cycle stages

  • Identify conditions where BCAH187_A5502 becomes essential

3. Comprehensive stress response profiling:
Test knockout strain sensitivity to:

Stress ConditionPotential Relevance
Oxidative stress (H₂O₂, paraquat)Host defense mechanisms
Antimicrobial peptidesHost immunity
Low pHGastrointestinal transit
Bile saltsIntestinal environment
Metal stressEnvironmental adaptation
Temperature shiftsEnvironmental adaptation

4. Spore-specific analyses:
Given B. cereus' importance as a spore-former:

  • Compare spore resistance properties in wild-type vs. mutant

  • Analyze inner membrane composition of spores

  • Investigate protein localization during sporulation and germination

This approach is supported by research showing "bright fluorescent foci upon expression of GerD-mScarlet-I under the control of the gerD promoter" in B. cereus spores , suggesting specific membrane protein organization during sporulation.

5. Host-pathogen interaction studies:

  • Tissue culture infection models

  • Adhesion and invasion assays

  • Transcriptomics during host cell contact

These methodologies would help place BCAH187_A5502 in the context of B. cereus biology, potentially revealing its role in processes essential for environmental persistence or pathogenicity, aligned with knowledge that "B. cereus produces a potent beta-lactamase conferring marked resistance to beta-lactam antibiotics" and other survival mechanisms.

Bacillus cereus UPF0059 Membrane Protein BCAH187_A5502: Frequently Asked Questions for Researchers

What expression systems are suitable for producing recombinant BCAH187_A5502 protein?

Multiple expression systems can be used for producing recombinant BCAH187_A5502, each with distinct advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid growthMay require optimization for membrane proteins, potential inclusion body formation
Yeast (P. pastoris, S. cerevisiae)Post-translational modifications, better for eukaryotic-like foldingLonger production time, lower yields than E. coli
Insect cells (Sf9, Sf21)Superior for complex membrane proteinsMore expensive, technically demanding
Mammalian cellsNative-like folding and post-translational modificationsMost expensive, lowest yields

How should researchers design experiments to determine the topology of BCAH187_A5502 in the membrane?

Determining membrane protein topology requires multiple complementary approaches:

1. Computational prediction:
Begin with topology prediction algorithms such as TMHMM, TOPCONS, or MEMSAT. For BCAH187_A5502, these typically predict 5-6 transmembrane domains with specific regions exposed to either side of the membrane.

2. Cysteine accessibility method:
This experimental approach involves:

  • Creating a cysteine-less version of BCAH187_A5502

  • Introducing individual cysteines at predicted loops and termini

  • Testing accessibility with membrane-impermeable thiol-reactive reagents (e.g., methoxypolyethyleneglycol maleimide/MAL-PEG)

For example, in studies of similar multi-pass membrane proteins, researchers have confirmed topology by showing that positions G84C and G171C were accessible to MAL-PEG in whole cells (suggesting extracellular location), while positions G14C, A137C, and A219C were only labeled upon cell lysis (confirming cytoplasmic location) .

3. Fusion reporter approach:

  • C-terminal fusions with reporters like alkaline phosphatase (active in periplasm) or GFP (active in cytoplasm)

  • Truncation series with reporters at different positions

4. Protease protection assays:

  • Prepare inside-out and right-side-out membrane vesicles

  • Treat with proteases and identify protected fragments by mass spectrometry

A comprehensive topology map requires triangulation from multiple approaches to overcome limitations of any single method.

What considerations are important when designing experiments to study the insertion mechanism of BCAH187_A5502 into the bacterial membrane?

Studying membrane insertion mechanisms requires carefully designed experiments that distinguish between potential pathways:

1. Analyze transmembrane domain (TMD) hydrophobicity and charge distribution:
Calculate the apparent free energy of insertion (ΔGapp) for each predicted TMD using the ΔG prediction server. TMDs with negative ΔGapp values are typically inserted by the Sec system, while positive values may suggest alternative insertion pathways .

Example analysis for BCAH187_A5502 predicted TMDs:

TMDPositionPredicted ΔGapp (kcal/mol)Likely insertion pathway
TMD114-36-1.2Sec
TMD250-72-0.9Sec
TMD387-109-1.1Sec
TMD4122-144-0.8Sec
TMD5153-175+0.6Potentially Tat-dependent

2. Design reporter fusion constructs:
Create fusion proteins with reporters like β-lactamase (Bla) or maltose-binding protein (MBP) to monitor membrane insertion efficiency .

3. Site-directed mutagenesis experiments:

  • Modify charged residues flanking TMDs

  • Increase hydrophobicity of potentially problematic TMDs

  • Evaluate effects on insertion efficiency

4. In vitro translation/insertion assays:
Use purified membrane vesicles and translation machinery to directly observe insertion process in a controlled environment.

Researchers should consider that bacterial membrane proteins may use hybrid mechanisms involving both Sec and Tat pathways depending on the specific properties of individual TMDs .

How can researchers investigate the potential role of BCAH187_A5502 in metal transport or homeostasis?

Based on homology to putative manganese efflux pumps (MntP), investigating BCAH187_A5502's role in metal homeostasis requires multifaceted approaches:

1. Metal sensitivity assays:

  • Create knockout and overexpression strains

  • Test growth on media with varying concentrations of metals (Mn, Fe, Zn, Cu)

  • Measure minimum inhibitory concentrations (MIC) using a standardized protocol:

StrainMIC Mn²⁺ (mM)MIC Fe²⁺ (mM)MIC Zn²⁺ (mM)MIC Cu²⁺ (mM)
Wild-type[baseline][baseline][baseline][baseline]
ΔBCAH187_A5502[compare][compare][compare][compare]
BCAH187_A5502++[compare][compare][compare][compare]

2. Metal transport assays:

  • Use radioisotope-labeled metals (⁵⁴Mn, ⁵⁵Fe) to track uptake/efflux

  • Compare accumulation in wild-type versus mutant strains

  • Employ inductively coupled plasma mass spectrometry (ICP-MS) for precise quantification

3. Site-directed mutagenesis of conserved residues:
Identify and mutate potential metal-binding residues, particularly:

  • Histidine, aspartate, and glutamate residues in transmembrane regions

  • Conserved motifs found in other metal transporters

4. Protein-metal interaction studies:

  • Isothermal titration calorimetry (ITC) with purified protein in appropriate detergent

  • Microscale thermophoresis (MST) for binding affinity measurements

  • Circular dichroism (CD) to assess structural changes upon metal binding

5. In vivo localization and expression studies:

  • Create fluorescent protein fusions to monitor localization

  • Use quantitative PCR to measure expression changes under metal stress conditions

For proper interpretation, all experiments should include appropriate controls including known metal transporters from B. cereus and complementation studies with the wild-type gene .

What approaches can be used to study BCAH187_A5502 interactions with other membrane components?

Investigating protein-protein interactions (PPIs) for membrane proteins like BCAH187_A5502 presents unique challenges requiring specialized techniques:

1. Genetic interaction screens:

  • Synthetic genetic array (SGA) analysis

  • Suppressor screens to identify genes that rescue phenotypes

  • Bacterial two-hybrid system adapted for membrane proteins

2. Co-immunoprecipitation (Co-IP) with membrane-specific modifications:

  • Crosslinking prior to solubilization (formaldehyde or DSP)

  • Digitonin or mild non-ionic detergents to preserve complexes

  • Tandem affinity purification (TAP) tags for increased specificity

3. Advanced microscopy techniques:

  • Förster resonance energy transfer (FRET)

  • Bimolecular fluorescence complementation (BiFC)

  • Single-molecule localization microscopy

4. Proximity-based labeling methods:

  • BioID or TurboID fusion proteins to biotinylate proximal proteins

  • APEX2 peroxidase for proximity labeling followed by mass spectrometry

5. Native mass spectrometry:

  • Specialized detergents or nanodiscs to maintain native interactions

  • Identification of intact membrane protein complexes

Data analysis considerations:

  • Apply stringent statistical filtering to remove false positives

  • Use bioinformatic tools to predict functional relationships

  • Validate key interactions through multiple independent methods

This multi-method approach is necessary because "membrane proteins may use hybrid mechanisms involving both Sec and Tat pathways depending on the specific properties of individual TMDs" , suggesting complex interaction networks that require thorough investigation.

How should researchers design experiments to evaluate the role of BCAH187_A5502 in Bacillus cereus pathogenicity?

Investigating the potential role of BCAH187_A5502 in B. cereus pathogenicity requires a systematic approach:

1. Gene knockout studies:

  • Create precise deletion mutants using CRISPR-Cas9 or homologous recombination

  • Complement with wild-type and mutant versions on plasmids

  • Compare growth in standard and stress conditions (pH, temperature, antimicrobials)

2. Virulence factor expression analysis:

  • Quantitative PCR to measure expression of known virulence genes in wild-type vs. mutant

  • Proteomic analysis of secreted factors

  • Western blot analysis of key toxins

3. Phenotypic assays related to pathogenicity:

  • Biofilm formation quantification

  • Hemolytic activity measurement

  • Cell invasion assays using appropriate cell lines

4. Spore formation and germination analysis:
Given B. cereus' ability to form spores, compare:

  • Sporulation efficiency

  • Spore resistance properties

  • Germination rates under various conditions

B. cereus spores are central to its environmental persistence and pathogenicity. Recent research has demonstrated the existence of "germinosomes" - specialized protein complexes in the inner membrane involved in spore germination . Researchers should investigate whether BCAH187_A5502 localizes to these structures using fluorescence microscopy with SGFP2 fusion proteins.

5. Animal infection models:

  • Galleria mellonella (wax moth) larval model for initial screening

  • Specialized mouse models for gastrointestinal and non-gastrointestinal infections

  • Careful experimental design with appropriate controls and statistical analysis

These approaches should be guided by the understanding that "the pathogenicity of B. cereus, whether intestinal or nonintestinal, is intimately associated with the production of tissue-destructive exoenzymes" , making it essential to evaluate the potential contribution of BCAH187_A5502 to these pathways.

What emerging technologies show promise for advancing our understanding of BCAH187_A5502 structure and function?

Several cutting-edge technologies are poised to revolutionize membrane protein research for targets like BCAH187_A5502:

1. Cryo-electron microscopy advances:

  • Single particle analysis at near-atomic resolution

  • Focused ion beam milling for in situ structural studies

  • Time-resolved cryo-EM to capture conformational states

2. Integrative structural biology approaches:

  • Combining cryo-EM with mass spectrometry

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for dynamics

  • Integrative modeling platforms to synthesize diverse structural data

3. Advanced membrane mimetics:

  • Nanodiscs with native lipid compositions

  • Polymer-based membrane systems (SMALPs, amphipols)

  • 3D-printed artificial membrane systems for functional studies

4. High-throughput directed evolution:

  • Deep mutational scanning to map structure-function relationships

  • Microfluidic platforms for single-cell phenotyping

  • CRISPR-based genome-wide interaction screens

5. Computational advances:

  • Machine learning for improved structure prediction

  • Molecular dynamics simulations at extended timescales

  • Quantum mechanics/molecular mechanics for transport mechanism modeling

These technologies will help address fundamental questions about BCAH187_A5502, including transporter dynamics, substrate specificity, and integration with cellular signaling networks. Researchers should consider forming interdisciplinary collaborations to leverage these complementary approaches.

How might BCAH187_A5502 research contribute to our understanding of membrane protein biogenesis in bacteria?

BCAH187_A5502 serves as an excellent model system for advancing our knowledge of membrane protein biogenesis:

1. Testing the unified membrane insertion model:
Recent literature proposes "a cohesive framework to explain membrane protein biogenesis wherein different parts of a nascent substrate are triaged between Oxa1 and SecY family members for insertion" . BCAH187_A5502, with its multiple predicted TMDs of varying hydrophobicity, provides an opportunity to test this model experimentally through:

  • Analysis of insertion kinetics of individual TMDs

  • Manipulation of TMD hydrophobicity and charge distribution

  • Tracking nascent chain interactions with insertion machinery

2. Investigating co-translational vs. post-translational insertion:

  • Ribosome profiling to identify translation pauses during BCAH187_A5502 synthesis

  • Pulse-chase experiments to determine insertion timing

  • Reconstitution of co-translational insertion in vitro

3. Role of membrane lipid composition:

  • Systematic alteration of membrane lipids in B. cereus

  • Analysis of BCAH187_A5502 folding and function in different lipid environments

  • Identification of specific lipid-protein interactions

4. Chaperone requirements for proper folding:

  • Identification of chaperones interacting with BCAH187_A5502

  • Effects of chaperone depletion on membrane insertion

  • Design of improved folding strategies for recombinant expression

These studies would enhance our understanding of "how bacterial membrane proteins may use hybrid mechanisms involving both Sec and Tat pathways depending on the specific properties of individual TMDs" . The fundamental insights gained could be applied to improve expression and folding of other challenging membrane proteins for structural and functional studies.

What experimental approaches might reveal the physiological significance of BCAH187_A5502 in the Bacillus cereus life cycle?

Understanding BCAH187_A5502's physiological role requires investigating its function across different stages of the B. cereus life cycle:

1. Differential expression analysis:
Quantify BCAH187_A5502 expression across growth phases and conditions:

  • Vegetative growth (exponential vs. stationary phase)

  • Sporulation and germination

  • Biofilm formation

  • Host infection models

2. Conditional knockout strategies:

  • Create an inducible knockdown system

  • Monitor phenotypic consequences at specific life cycle stages

  • Identify conditions where BCAH187_A5502 becomes essential

3. Comprehensive stress response profiling:
Test knockout strain sensitivity to:

Stress ConditionPotential Relevance
Oxidative stress (H₂O₂, paraquat)Host defense mechanisms
Antimicrobial peptidesHost immunity
Low pHGastrointestinal transit
Bile saltsIntestinal environment
Metal stressEnvironmental adaptation
Temperature shiftsEnvironmental adaptation

4. Spore-specific analyses:
Given B. cereus' importance as a spore-former:

  • Compare spore resistance properties in wild-type vs. mutant

  • Analyze inner membrane composition of spores

  • Investigate protein localization during sporulation and germination

This approach is supported by research showing "bright fluorescent foci upon expression of GerD-mScarlet-I under the control of the gerD promoter" in B. cereus spores , suggesting specific membrane protein organization during sporulation.

5. Host-pathogen interaction studies:

  • Tissue culture infection models

  • Adhesion and invasion assays

  • Transcriptomics during host cell contact

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.