Recombinant Bacillus cereus UPF0059 membrane protein BCAH820_5416 (BCAH820_5416)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Bacillus cereus UPF0059 membrane protein BCAH820_5416 (BCAH820_5416) is a full-length protein derived from the Bacillus cereus strain AH820. This protein, expressed in Escherichia coli and fused with an N-terminal His tag, serves as a critical tool for studying membrane-associated functions in B. cereus and related species .

Primary Structure

  • UniProt ID: B7JGQ0

  • Amino Acid Sequence: Full-length (1–182 residues)

  • Tag: N-terminal His tag for purification

Key Features

  • Expression System: E. coli

  • Form: Lyophilized powder

  • Predicted Molecular Weight: ~20–27 kDa (exact mass depends on post-translational modifications)

Production and Purification

The protein is produced via recombinant DNA technology, leveraging E. coli’s robust expression capabilities. Post-expression, it is purified using affinity chromatography targeting the His tag, ensuring high purity .

5.1. Immunoassays

BCAH820_5416 is utilized in ELISA kits for antibody generation and detection, leveraging its His tag for immobilization .

5.3. Functional Screening

Its availability enables high-throughput assays to identify inhibitors or binding partners .

Research Gaps and Future Directions

  • Functional Annotation: The exact biological role of BCAH820_5416 remains uncharacterized. Homology modeling or knockout studies could clarify its contribution to B. cereus physiology.

  • Pathogenicity Links: While B. cereus membrane proteins often mediate virulence (e.g., toxin secretion), no direct evidence ties BCAH820_5416 to pathogenicity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mntP; BCAH820_5416; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus cereus (strain AH820)
Target Names
mntP
Target Protein Sequence
MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALKIRQILYIGVTIGIFHIIMPFIGMVLGR FLSEQYGDIAHFAGAILLIGLGFYIVYSSILENEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTIITILLFGFVSMLLAWIGLLIGRHAKGMLGTYGEIVGGIILVGFGLYLLF PI
Uniprot No.

Target Background

Function

This protein likely functions as a manganese efflux pump.

Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of B. cereus UPF0059 membrane protein BCAH820_5416?

The UPF0059 membrane protein family, including BCAH820_5416 from B. cereus, belongs to a group of transmembrane proteins with predicted functions in ion transport across bacterial membranes. Structural analyses suggest that these proteins typically contain 4-6 transmembrane domains with both N and C termini located in the cytoplasm. Unlike the BVU_2631 protein from Bacteroides vulgatus (which contains 190 amino acids arranged in a specific transmembrane configuration), the BCAH820_5416 protein may have slight structural variations while maintaining the core UPF0059 family characteristics .

The protein can be analyzed using a combination of bioinformatic prediction tools and experimental techniques:

  • Hydropathy plots and transmembrane domain prediction software for computational analysis

  • Circular dichroism (CD) spectroscopy for secondary structure determination

  • Limited proteolysis coupled with mass spectrometry for topology mapping

  • X-ray crystallography or cryo-electron microscopy for high-resolution structural determination (though these remain challenging for membrane proteins)

How can I optimize the recombinant expression of B. cereus BCAH820_5416 membrane protein in E. coli?

Successful recombinant expression of BCAH820_5416 requires careful optimization due to its hydrophobic nature as a membrane protein. Based on established protocols for similar membrane proteins, the following methodology is recommended:

  • Vector selection: Use vectors with tunable promoters (like pET series) with an N-terminal His-tag for purification .

  • Host strain selection: BL21(DE3) derivatives or C41/C43 strains specifically developed for membrane protein expression.

  • Expression conditions:

    • Induction at lower temperatures (16-20°C) to reduce inclusion body formation

    • Lower IPTG concentrations (0.1-0.5 mM) for slower expression

    • Addition of membrane-stabilizing compounds (e.g., glycerol at 5-10%)

  • Membrane fraction isolation protocol:

    • Cell lysis by sonication or French press

    • Differential centrifugation (low-speed followed by high-speed ultracentrifugation)

    • Membrane solubilization using appropriate detergents (DDM, LDAO, or C12E8)

Storage conditions should include buffer with detergent above its critical micelle concentration, with 6% trehalose to improve stability, similar to protocols for other membrane proteins .

What are the recommended purification techniques for B. cereus BCAH820_5416 recombinant protein?

Purification of BCAH820_5416 should employ a multi-step chromatography approach tailored for membrane proteins:

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Ni-NTA or TALON resin for His-tagged protein

    • Equilibration and washing buffers containing 0.02-0.05% detergent

    • Gradual imidazole gradient for elution (20-250 mM)

  • Size Exclusion Chromatography (SEC):

    • Superdex 200 or Sephacryl S-300 columns

    • Running buffer with detergent concentration just above CMC

    • Addition of 6% trehalose for stability enhancement

  • Quality control:

    • SDS-PAGE analysis (>90% purity standard)

    • Western blotting for identity confirmation

    • Dynamic light scattering for aggregation assessment

The purified protein should be stored in Tris/PBS-based buffer (pH 8.0) with 6% trehalose. Aliquoting is necessary to avoid freeze-thaw cycles, with recommended storage at -20°C/-80°C for long-term preservation .

How can CRISPR/Cas9 be utilized for functional studies of BCAH820_5416 in B. cereus?

CRISPR/Cas9 genome editing provides a powerful approach for studying BCAH820_5416 function through precise genetic modifications. Based on successful applications in B. cereus and related species, the following methodology is recommended:

  • sgRNA design:

    • Target specific regions of BCAH820_5416 gene

    • Utilize sgRNA design software to minimize off-target effects

    • Incorporate 20-nt guide sequence adjacent to a PAM site (NGG)

  • Plasmid construction:

    • Create a vector containing Cas9 gene under an inducible promoter (e.g., mannose-inducible)

    • Include the sgRNA expression cassette

    • Incorporate a template for homology-directed repair with desired mutations

    • Add kanamycin resistance marker (25 μg/ml) for selection

  • Transformation protocol:

    • Prepare electrocompetent B. cereus cells

    • Electroporate with prepared plasmid (0.6 kV, 500 Ω, 25 μF)

    • Incubate at 30°C for recovery

    • Select transformants on kanamycin-containing media

  • Induction and mutant selection:

    • Induce Cas9 expression with mannose (0.4% w/v) at 28°C

    • Screen colonies for successful edits via PCR and sequencing

    • Eliminate editing plasmid through serial passages without selection

    • Confirm phenotypic changes through functional assays

This approach enables various genetic modifications including point mutations, deletions, or insertions without leaving antibiotic selection markers in the final strain, facilitating precise functional analysis of BCAH820_5416 .

What role might BCAH820_5416 play in B. cereus pathogenicity and how can this be experimentally determined?

Understanding BCAH820_5416's potential role in pathogenicity requires a multi-faceted experimental approach:

  • Comparative genomic analysis:

    • Compare BCAH820_5416 sequences across pathogenic and non-pathogenic Bacillus strains

    • Identify conserved domains that correlate with virulence

  • Gene knockout/knockdown studies:

    • Generate BCAH820_5416 deletion mutants using CRISPR/Cas9

    • Create conditional expression strains for essential genes

    • Compare growth rates, morphology, and stress responses between mutant and wild-type strains

  • Virulence assays:

    • Hemolysis activity assessment on blood agar plates

    • Phospholipase activity measurement using specific substrates

    • Cytotoxicity assessment using cell culture models

    • Insect or mouse infection models for in vivo virulence evaluation

  • Transcriptomic and proteomic profiling:

    • RNA-seq analysis comparing wild-type and mutant strains

    • Proteomic comparison of membrane fractions

    • Identification of differentially expressed virulence factors

If BCAH820_5416 functions similarly to other membrane proteins in the B. cereus group, it might be involved in ion transport, stress response, or cellular signaling pathways that indirectly affect virulence factor production and regulation, similar to how the plcR regulatory system influences hemolytic and phospholipase activities .

How can I develop detection systems for B. cereus using BCAH820_5416 as a target?

Developing detection systems targeting BCAH820_5416 can provide specific identification of B. cereus in various samples. The following methodological approach is recommended:

  • Bioreceptor development:

    • Generate recombinant antibodies against BCAH820_5416

    • Alternatively, identify phage-derived proteins with specific binding to B. cereus membrane proteins

    • Engineer cell-wall-binding domains (CBDs) or distal tail proteins (Dit) from bacteriophages that target B. cereus

  • Lateral flow assay (LFA) development:

    • Conjugate bioreceptors to gold nanoparticles (AuNPs)

    • Optimize conjugation conditions to maintain protein orientation and function

    • Immobilize capture bioreceptors on nitrocellulose membranes

    • Establish assay parameters for rapid detection (within 15 minutes)

  • Detection system optimization:

    • Characterize binding properties at microstructural and biointerface levels

    • Determine limit of detection (targeting approximately 10^5 B. cereus cells)

    • Evaluate cross-reactivity with related Bacillus species

    • Assess performance in complex food matrices or environmental samples

  • Validation and performance metrics:

    • Compare with conventional culture-based methods

    • Determine sensitivity, specificity, and predictive values

    • Assess shelf-life and field stability

This approach provides a rapid, specific, and user-friendly detection method that can be applied in field settings without requiring specialized equipment or extensive sample preparation .

What protein-protein interaction methods are most suitable for studying BCAH820_5416 interactions with other cellular components?

Membrane protein interaction studies present unique challenges due to their hydrophobic nature. For BCAH820_5416, the following methodologies are recommended:

MethodAdvantagesLimitationsSuitable Applications
Membrane Yeast Two-HybridIn vivo context, detects weak interactionsLimited to binary interactionsInitial screening of interaction partners
Co-immunoprecipitation with crosslinkingPreserves native membrane environmentPotential for non-specific bindingValidation of predicted interactions
Surface Plasmon ResonanceLabel-free, real-time kineticsRequires purified componentsDetailed binding kinetics analysis
Microscale ThermophoresisMinimal sample requirements, native-like conditionsComplex data interpretationWorking with limited protein amounts
FRET/BRET AssaysIn vivo monitoring, spatial resolutionRequires fluorescent taggingDynamic interaction studies
Blue Native PAGEPreserves native complexesLimited resolutionIdentification of stable complexes

For comprehensive interaction mapping, a combination of these techniques should be employed:

  • Initial screening using membrane yeast two-hybrid or proximity labeling approaches

  • Validation of potential interactions using co-immunoprecipitation with membrane-specific crosslinkers

  • Detailed characterization of confirmed interactions using biophysical methods

This multi-technique approach helps overcome the limitations of individual methods and provides more reliable interaction data for membrane proteins like BCAH820_5416.

How can I assess the ion transport function of BCAH820_5416?

Based on its classification as a UPF0059 family membrane protein, BCAH820_5416 may function in ion transport. To characterize this function:

  • Liposome reconstitution assay:

    • Purify BCAH820_5416 protein to >90% purity

    • Reconstitute into liposomes of defined lipid composition

    • Load liposomes with ion-sensitive fluorescent dyes

    • Measure fluorescence changes upon creation of ion gradients

    • Compare transport rates with and without specific inhibitors

  • Electrophysiological methods:

    • Planar lipid bilayer recordings

    • Patch-clamp analysis of proteoliposomes

    • Measurement of current-voltage relationships under varying ion concentrations

  • Cellular assays:

    • Express BCAH820_5416 in ion transport-deficient bacterial or yeast strains

    • Assess growth complementation under various ionic conditions

    • Measure intracellular ion concentrations using specific probes

  • In silico analysis:

    • Molecular dynamics simulations of ion conductance

    • Identification of potential ion-binding sites

    • Prediction of transport mechanisms based on structural models

By combining these approaches, researchers can determine if BCAH820_5416 functions in manganese efflux (similar to MntP) or transports other ions, and characterize its transport kinetics, substrate specificity, and regulatory mechanisms.

What are the best approaches for analyzing post-translational modifications of BCAH820_5416?

Post-translational modifications (PTMs) can significantly impact membrane protein function. For BCAH820_5416, the following analytical workflow is recommended:

  • Sample preparation:

    • Isolate membrane fractions from B. cereus cultures under various growth conditions

    • Enrich for BCAH820_5416 using immunoprecipitation or affinity purification

    • Perform on-bead or in-gel digestion with multiple proteases (trypsin, chymotrypsin, Glu-C)

  • Mass spectrometry analysis:

    • LC-MS/MS analysis using high-resolution instruments (Orbitrap or Q-TOF)

    • Implement fragmentation techniques optimized for PTM analysis (HCD, ETD, EThcD)

    • Use data-dependent and data-independent acquisition methods

    • Apply targeted methods (PRM, MRM) for quantification of specific modifications

  • Bioinformatic analysis:

    • Search against custom databases including potential modifications

    • Apply appropriate false discovery rate controls

    • Use PTM localization scoring algorithms

    • Validate results with site-directed mutagenesis of modified residues

  • Functional validation:

    • Generate site-specific mutants that mimic or prevent modification

    • Assess the impact on protein localization, stability, and function

    • Compare PTM patterns under different physiological conditions

Common PTMs to investigate include phosphorylation, methylation, and lipid modifications, which are frequently observed in bacterial membrane proteins and can regulate their function, localization, and interaction with other cellular components.

What are the common challenges in working with BCAH820_5416 and how can they be overcome?

Working with membrane proteins like BCAH820_5416 presents several challenges that require specific troubleshooting approaches:

  • Low expression yields:

    • Optimize codon usage for the expression host

    • Use fusion partners (MBP, SUMO) to enhance solubility

    • Screen multiple expression vectors and host strains

    • Consider cell-free expression systems for toxic proteins

  • Protein aggregation/inclusion body formation:

    • Lower induction temperature to 16-20°C

    • Reduce inducer concentration

    • Add chemical chaperones to expression media (glycerol, betaine)

    • Consider refolding protocols from inclusion bodies with carefully optimized detergent screens

  • Purification difficulties:

    • Screen multiple detergents for optimal solubilization

    • Use fluorescence-detection size exclusion chromatography (FSEC) to evaluate protein stability

    • Implement stringent quality control at each purification step

    • Consider lipid addition during purification to stabilize the protein

  • Functional assay limitations:

    • Develop multiple orthogonal assays to validate function

    • Control for detergent effects in all functional assays

    • Consider native nanodiscs or styrene-maleic acid lipid particles (SMALPs) for detergent-free preparations

  • Crystallization challenges:

    • Screen lipidic cubic phase (LCP) crystallization for membrane proteins

    • Utilize thermostabilizing mutations to enhance crystallizability

    • Consider cryo-EM as an alternative structural approach

By systematically addressing these challenges, researchers can improve their success in working with challenging membrane proteins like BCAH820_5416.

How can I design experiments to investigate the role of BCAH820_5416 in antimicrobial resistance?

To investigate BCAH820_5416's potential role in antimicrobial resistance, a comprehensive experimental design should include:

  • Comparative expression analysis:

    • Compare BCAH820_5416 expression levels between resistant and sensitive B. cereus strains

    • Analyze expression changes upon exposure to sub-inhibitory antibiotic concentrations

    • Perform qRT-PCR and western blotting to quantify changes at mRNA and protein levels

  • Genetic manipulation:

    • Generate overexpression strains using inducible promoters

    • Create knockout or knockdown strains using CRISPR/Cas9 genome editing

    • Develop point mutations in specific functional domains

  • Phenotypic characterization:

    • Determine minimum inhibitory concentrations (MICs) for various antibiotics

    • Conduct time-kill assays to assess killing kinetics

    • Perform membrane permeability assays using fluorescent dyes

    • Measure efflux activity using specific substrates

  • Biochemical characterization:

    • Assess direct interaction with antibiotics using binding assays

    • Investigate changes in membrane potential or ion flux

    • Determine if BCAH820_5416 functions as an efflux pump component

  • Systems-level analysis:

    • Conduct transcriptomic analysis of wild-type vs. mutant strains

    • Perform proteomic analysis focusing on membrane fraction

    • Identify potential interaction partners involved in resistance

This multi-faceted approach will provide comprehensive insights into whether BCAH820_5416 directly contributes to antimicrobial resistance (e.g., through efflux mechanisms) or indirectly affects resistance through other cellular processes like membrane permeability or stress response regulation.

What approaches can be used to compare BCAH820_5416 with homologous proteins in other Bacillus species?

Comparative analysis of BCAH820_5416 with homologs can provide valuable insights into its function and evolution. A systematic approach includes:

  • Sequence-based analysis:

    • Multiple sequence alignment of homologs across Bacillus species

    • Phylogenetic tree construction to establish evolutionary relationships

    • Identification of conserved motifs and variable regions

    • Analysis of selection pressure on different protein domains

  • Structural comparison:

    • Homology modeling based on available structures of related proteins

    • Molecular dynamics simulations to compare conformational dynamics

    • Virtual screening to identify potential ligands

    • Structural alignment to identify conserved functional sites

  • Functional comparison:

    • Heterologous expression of homologs in a common host

    • Direct comparison of biochemical activities under identical conditions

    • Complementation studies in knockout strains

    • Domain-swapping experiments to identify functional determinants

  • Physiological role comparison:

    • Growth profiling under various stress conditions

    • Transcriptional response analysis

    • Assessment of virulence phenotypes in pathogenic species

    • Evaluation of interactions with conserved partner proteins

This comparative approach can reveal whether BCAH820_5416 shares functional similarities with proteins like the PlcR regulatory system in B. cereus or has evolved unique functions specific to its ecological niche or pathogenic lifestyle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.