Recombinant Bacillus cereus UPF0059 membrane protein BCB4264_A5447 (BCB4264_A5447)

Shipped with Ice Packs
In Stock

Description

Reconstitution and Handling

  • Reconstitution: Recommended in deionized sterile water at 0.1–1.0 mg/mL, with optional addition of 5–50% glycerol for long-term storage .

  • Storage:

    • Primary: -20°C or -80°C (avoid repeated freeze-thaw cycles).

    • Working Aliquots: 4°C for ≤1 week .

Functional Inference and Research Context

While direct experimental data on BCB4264_A5447’s function is scarce, its annotation as mntP implies involvement in manganese efflux, a process critical for maintaining intracellular metal homeostasis. This aligns with known bacterial strategies to manage metal toxicity. By contrast, other B. cereus transporters, such as BC3310 (a multidrug efflux pump), have been characterized for antibiotic resistance .

Comparative Analysis of Transporters

ProteinFunctionSubstrateSource
BCB4264_A5447Putative manganese efflux pump (mntP)Manganese ionsB. cereus B4264
BC3310Multidrug efflux pumpEthidium bromide, antibioticsB. cereus ATCC 14579

Research Applications

This recombinant protein serves as a tool for studying:

  • Membrane Transport Mechanisms: Insights into manganese homeostasis in B. cereus.

  • Diagnostic Development: Potential use in ELISA assays for detecting B. cereus or related pathogens, as indicated by commercial ELISA kits targeting this protein .

  • Structural Biology: High-purity samples enable crystallography or cryo-EM studies to resolve its 3D structure.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mntP; BCB4264_A5447; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus cereus (strain B4264)
Target Names
mntP
Target Protein Sequence
MTFEQLIPLIIMAFALGMDAFSVSLGMGMMPLKLRQILYIGMTIGIFHIIMPFIGMVLGR FLSEKYGDIAHFAGAILLIGLGFYIVYSTILQNEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTIITILLFGFVSMLLAWIGLLIGRHAKDMLGTYGEIVGGIILVGFGLYILF PI
Uniprot No.

Target Background

Function

This protein likely functions as a manganese efflux pump.

Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the general function of UPF0059 membrane proteins in Bacillus cereus?

UPF0059 membrane proteins in Bacillus cereus belong to a family of uncharacterized proteins with predicted membrane-spanning domains. While the specific function of BCB4264_A5447 remains to be fully elucidated, membrane proteins in B. cereus typically serve crucial roles in cellular processes including nutrient transport, signal transduction, and virulence factor secretion.

Methodological approach for characterization:

  • Comparative genomic analysis across the B. cereus group to identify conserved domains

  • Transmembrane topology prediction using algorithms such as TMHMM or Phobius

  • Structural homology modeling based on related proteins with known functions

  • Gene knockout studies to observe phenotypic changes

  • Transcriptomic analysis under various environmental conditions to determine expression patterns

These approaches should be conducted in conjunction with established B. cereus cultivation techniques as described in standard bacteriological protocols .

How does BCB4264_A5447 relate to virulence mechanisms in Bacillus cereus?

The relationship between BCB4264_A5447 and virulence mechanisms requires systematic investigation since B. cereus pathogenicity depends on numerous virulence factors, including membrane-associated proteins that may interact with or facilitate the secretion of toxins.

Based on what we know about B. cereus virulence mechanisms, investigation could include:

  • Correlation analysis between BCB4264_A5447 expression and production of known toxins (Hbl, Nhe, cytK, entFM)

  • Determining potential involvement in secretion pathways for enterotoxins

  • Analysis of protein-protein interactions with established virulence factors

  • Comparative virulence assays between wild-type and BCB4264_A5447 mutant strains

Virulence FactorPrevalence in B. cereusPotential Association Method
Hbl toxin complex39% of isolatesCo-immunoprecipitation with BCB4264_A5447
Nhe toxin complex83% of isolatesBacterial two-hybrid screening
CytK68% of isolatesTranscription correlation analysis
EntFM100% of isolatesSecretion pathway dependency testing

Investigation of these relationships should employ methodologies similar to those used in characterizing other B. cereus virulence factors, including PCR-based detection of virulence genes and phenotypic assays .

What structural characteristics define the UPF0059 membrane protein family in Bacillus cereus?

The UPF0059 family of membrane proteins typically contains multiple transmembrane domains arranged in a specific topology. While limited structural data exists specifically for BCB4264_A5447, addressing this question requires:

  • Primary sequence analysis to identify conserved motifs and domains

  • Secondary structure prediction using computational tools

  • Hydrophobicity analysis to determine membrane-spanning regions

  • Homology modeling based on structurally characterized membrane proteins

  • Experimental structure determination approaches:

    • X-ray crystallography following detergent-based purification

    • Cryo-electron microscopy for visualization in native-like lipid environments

    • NMR spectroscopy for dynamic structural elements

Researchers should optimize purification conditions that maintain protein stability while removing it from its native membrane environment, a critical challenge in membrane protein structural biology.

What are the recommended approaches for resolving the three-dimensional structure of BCB4264_A5447?

Determining the 3D structure of membrane proteins presents significant technical challenges. For BCB4264_A5447, researchers should consider a multi-faceted approach:

  • Recombinant expression optimization:

    • Expression host selection (E. coli, yeast, insect cells)

    • Fusion tags (His, GST, MBP) to enhance solubility and purification

    • Codon optimization for the expression system

  • Detergent screening for extraction and purification:

    • Mild detergents (DDM, LMNG) for initial extraction

    • Detergent exchange during purification to identify optimal stability

    • Lipid nanodisc or amphipol reconstitution for functional studies

  • Structural determination methods:

    • X-ray crystallography with vapor diffusion or lipidic cubic phase

    • Single-particle cryo-EM analysis

    • Solid-state NMR for in-membrane structure determination

  • Validation approaches:

    • Circular dichroism to confirm secondary structure integrity

    • Size-exclusion chromatography with multi-angle light scattering to assess oligomerization

    • Functional assays to confirm biological activity of purified protein

The selection of methods should be guided by the specific properties of BCB4264_A5447 and available research infrastructure.

What are the optimal conditions for heterologous expression of recombinant BCB4264_A5447?

Successful expression of membrane proteins requires careful optimization of multiple parameters. For BCB4264_A5447, consider the following approach:

  • Expression system selection:

    • E. coli BL21(DE3) for initial trials

    • C41/C43 strains for potentially toxic membrane proteins

    • Bacillus subtilis for closer native environment

  • Expression vector design:

    • Inducible promoter (T7, araBAD)

    • Fusion tags (N-terminal or C-terminal)

    • Signal sequences for proper membrane targeting

  • Growth and induction conditions:

    • Temperature (typically lower temperatures of 16-25°C for membrane proteins)

    • Induction timing (mid-log phase generally optimal)

    • Inducer concentration (gradual induction often beneficial)

  • Scale-up considerations:

    • Bioreactor parameters (dissolved oxygen, pH control)

    • Feed strategies for high-density cultures

Expression ParameterRecommended RangeOptimization Method
Growth temperature16-30°CParallel small-scale cultures
IPTG concentration0.1-1.0 mMInduction gradient testing
Post-induction time4-24 hoursTime-course analysis
Media compositionLB, TB, minimal mediaComparative yield testing

Expression levels should be monitored by Western blotting using tag-specific antibodies or, if available, antibodies against BCB4264_A5447 directly.

What purification strategy ensures optimal yield and stability of BCB4264_A5447?

Purification of membrane proteins requires specialized approaches. For BCB4264_A5447, a systematic purification strategy would include:

  • Membrane isolation and solubilization:

    • Cell disruption methods (sonication, high-pressure homogenization)

    • Differential centrifugation for membrane fraction isolation

    • Detergent screening for effective solubilization (DDM, LMNG, Triton X-100)

  • Chromatographic purification:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

    • Size exclusion chromatography for final polishing and buffer exchange

    • Ion exchange chromatography if additional purity is required

  • Stability optimization:

    • Buffer composition (pH, ionic strength, glycerol addition)

    • Lipid addition during purification

    • Detergent concentration maintenance above CMC

  • Quality assessment:

    • SDS-PAGE and Western blotting

    • Mass spectrometry for identity confirmation

    • Dynamic light scattering for homogeneity analysis

    • Thermal stability assays (DSF or nanoDSF)

Throughout purification, it's essential to maintain conditions that preserve the native conformation and function of the protein, which may require empirical optimization for this specific membrane protein.

How can researchers determine the physiological role of BCB4264_A5447 in Bacillus cereus?

Determining the physiological role of an uncharacterized membrane protein requires multiple complementary approaches:

  • Genetic manipulation:

    • Gene knockout or knockdown (CRISPR-Cas, antisense RNA)

    • Phenotypic characterization of mutant strains

    • Complementation studies to confirm phenotype specificity

  • Expression analysis:

    • qRT-PCR under various growth conditions

    • Proteomic profiling to identify co-regulated proteins

    • Reporter gene fusions to monitor expression patterns

  • Localization studies:

    • Fluorescent protein fusions

    • Immunolocalization with specific antibodies

    • Subcellular fractionation followed by Western blotting

  • Protein-protein interaction analysis:

    • Bacterial two-hybrid screening

    • Co-immunoprecipitation with potential partners

    • Crosslinking studies followed by mass spectrometry

  • Functional assays based on predicted activities:

    • Transport assays if channel/transporter function is suspected

    • Enzymatic activity measurements if catalytic function is predicted

    • Signaling cascade analysis if involved in signal transduction

These approaches should be conducted in the context of B. cereus biology, considering its growth conditions, virulence mechanisms, and environmental adaptations .

What methodologies are most appropriate for investigating potential interactions between BCB4264_A5447 and B. cereus virulence factors?

Given the importance of membrane proteins in bacterial virulence, investigating potential interactions between BCB4264_A5447 and known B. cereus virulence factors requires specialized approaches:

  • Co-expression analysis:

    • Transcriptomic profiling under virulence-inducing conditions

    • Correlation of BCB4264_A5447 expression with toxin gene expression

    • qRT-PCR validation of co-regulated genes

  • Protein-protein interaction studies:

    • Pull-down assays with purified BCB4264_A5447

    • Bacterial two-hybrid screening against virulence factor library

    • Surface plasmon resonance to measure binding affinities

  • Functional impact assessment:

    • Toxin secretion efficiency in wild-type vs. mutant strains

    • Hemolytic activity assays

    • Cell culture infection models

    • Insect or animal virulence models

  • Structural biology approaches:

    • Co-crystallization attempts with virulence factors

    • Crosslinking coupled with mass spectrometry

    • Computational docking with known virulence factor structures

Virulence FactorDetection MethodInteraction Assessment Technique
Hbl complexPCR, Western blotCo-immunoprecipitation, ELISA
Nhe complexPCR, Western blotBacterial two-hybrid, FRET
CytKPCR, Western blotPull-down assay, SPR
EntFMPCR, Western blotCrosslinking, proximity labeling

The presence of various virulence genes in B. cereus (hblACD, nheABC, cytK, entFM, cesB) provides potential targets for investigating interactions with BCB4264_A5447 .

How can comparative genomics inform our understanding of BCB4264_A5447 evolution and specialization within the B. cereus group?

The B. cereus group comprises closely related species including B. cereus sensu stricto, B. anthracis, B. thuringiensis, B. mycoides, B. pseudomycoides, and B. cytotoxicus . Comparative genomic approaches can reveal important insights about BCB4264_A5447:

  • Ortholog identification and analysis:

    • Identification of BCB4264_A5447 orthologs across the B. cereus group

    • Sequence conservation and divergence patterns

    • Selection pressure analysis (dN/dS ratios)

  • Synteny and genomic context analysis:

    • Conservation of neighboring genes

    • Operon structure prediction

    • Horizontal gene transfer assessment

  • Domain architecture comparison:

    • Identification of conserved domains across species

    • Lineage-specific domain acquisitions or losses

    • Functional diversification assessment

  • Phylogenetic analysis:

    • Reconstruction of BCB4264_A5447 evolutionary history

    • Correlation with species divergence patterns

    • Identification of key adaptation events

  • Structural prediction comparisons:

    • Conservation of structural features across orthologs

    • Species-specific structural adaptations

    • Structure-function relationship inferences

This approach can reveal whether BCB4264_A5447 has undergone specialization in B. cereus compared to related species, potentially correlating with pathogenic potential or ecological niche adaptation.

What are the challenges and solutions in developing antibodies or small molecule inhibitors targeting BCB4264_A5447?

Developing molecular tools to study or inhibit BCB4264_A5447 presents several challenges:

  • Immunogen preparation challenges:

    • Difficulty expressing full-length membrane proteins

    • Conformational epitope preservation

    • Potential solutions:

      • Synthetic peptide antigens from predicted extracellular loops

      • Recombinant protein fragments expressed as soluble domains

      • Detergent-solubilized full-length protein

  • Small molecule screening approaches:

    • Structure-based virtual screening if homology models are available

    • Fragment-based drug discovery

    • High-throughput functional assays once activity is determined

  • Validation methodologies:

    • Binding assays (SPR, microscale thermophoresis)

    • Functional inhibition assays

    • Specificity testing against related proteins

  • Development of fluorescent or biotinylated probes:

    • Site-specific labeling strategies

    • Activity-based protein profiling

    • Cellular imaging applications

  • Application in research and potential therapeutic contexts:

    • Use as research tools for protein localization

    • Functional inhibition to determine physiological roles

    • Potential antimicrobial development if essential for pathogenicity

These tools would be valuable for understanding BCB4264_A5447 function and potentially for developing novel antimicrobials targeting B. cereus, which shows resistance to multiple antibiotics including β-lactams .

How does research on BCB4264_A5447 contribute to our understanding of B. cereus pathogenicity in food poisoning outbreaks?

B. cereus is a significant cause of food poisoning, particularly in ready-to-eat foods . Research on BCB4264_A5447 can contribute to understanding pathogenicity through:

  • Functional associations with known virulence mechanisms:

    • Potential role in toxin secretion or regulation

    • Involvement in adhesion to host cells

    • Contribution to stress resistance in food environments

  • Expression profiling in food-related conditions:

    • Transcriptomic analysis in different food matrices

    • Response to food preservation techniques

    • Expression during spore formation and germination

  • Comparative analysis in clinical isolates:

    • Sequence variations in food poisoning outbreak strains

    • Association with toxin production levels

    • Correlation with illness severity

  • Integration with food safety research:

    • Development of detection methods targeting BCB4264_A5447

    • Assessment of expression under food processing conditions

    • Potential as a biomarker for virulent strains

This research could enhance our understanding of how B. cereus causes food poisoning beyond the currently known toxin mechanisms, potentially leading to improved detection or control strategies.

What methodological approaches can resolve contradictory data regarding BCB4264_A5447 function across different experimental systems?

When facing contradictory data about membrane protein function, systematic troubleshooting approaches are essential:

  • Experimental system standardization:

    • Defined genetic backgrounds (strain selection, validation)

    • Consistent growth and induction conditions

    • Standardized protein preparation protocols

  • Multi-method validation:

    • Orthogonal functional assays

    • In vitro and in vivo assessment

    • Both gain-of-function and loss-of-function approaches

  • Technical variables consideration:

    • Detergent effects on protein conformation and activity

    • Tag interference with protein function

    • Expression level artifacts

  • Systematic parameter variation:

    • pH, temperature, ionic strength testing

    • Substrate concentration ranges

    • Time-course analyses

  • Advanced validation approaches:

    • Single-molecule techniques

    • Native mass spectrometry

    • In-membrane functional assessment

Common Contradiction SourceInvestigation MethodResolution Approach
Expression system artifactsComparative expressionUse multiple systems and compare
Detergent effectsDetergent screeningReconstitute in lipid nanodiscs
Tag interferenceTag position variationGenerate tag-free protein
Oligomerization state differencesSEC-MALS analysisCross-validate with native MS
Post-translational modificationsMS/MS analysisMap modifications and their impact

By systematically addressing these variables, researchers can resolve contradictions and develop a consensus model of BCB4264_A5447 function.

How might CRISPR-Cas9 genome editing accelerate functional characterization of BCB4264_A5447 in B. cereus?

CRISPR-Cas9 technology offers powerful approaches for the functional characterization of BCB4264_A5447:

  • Precise genetic manipulation strategies:

    • Clean gene knockout without polar effects

    • Point mutations to target specific protein domains

    • Promoter modifications to control expression levels

    • Epitope tagging at endogenous loci

  • Implementation methodology:

    • Delivery system optimization (electroporation, conjugation)

    • Guide RNA design for B. cereus genome specificity

    • Homology-directed repair template design

    • Screening strategies for successful edits

  • Advanced applications:

    • CRISPRi for titratable gene repression

    • CRISPRa for enhanced expression

    • Multiplexed editing of related genes

    • CRISPR-based imaging for protein localization

  • Experimental design for functional assessment:

    • Comparative phenotypic analysis of edited strains

    • Fitness assessment under various conditions

    • Virulence factor production and secretion

    • Host-pathogen interaction models

CRISPR-based approaches could overcome traditional limitations in genetic manipulation of B. cereus, enabling more precise investigation of BCB4264_A5447 function in its native context.

What emerging structural biology techniques hold promise for elucidating the dynamic conformational states of BCB4264_A5447?

Membrane proteins often function through conformational changes. Advanced structural biology techniques to capture these dynamics include:

  • Cryo-electron microscopy advances:

    • Time-resolved cryo-EM for conformational transitions

    • Lipid nanodisc reconstitution for native-like environment

    • Single-particle analysis of multiple conformational states

    • Tomography for in situ structural determination

  • Advanced spectroscopic methods:

    • Hydrogen-deuterium exchange mass spectrometry

    • EPR spectroscopy with site-directed spin labeling

    • Single-molecule FRET for conformational dynamics

    • Solid-state NMR for membrane-embedded structures

  • Computational approaches:

    • Molecular dynamics simulations in membrane environments

    • Enhanced sampling techniques for rare conformations

    • Markov state modeling of conformational transitions

    • Machine learning for structural prediction

  • Integrative structural biology:

    • Combination of multiple experimental datasets

    • Cross-linking mass spectrometry for distance constraints

    • Small-angle X-ray scattering for solution confirmation

    • Computational integration of diverse structural restraints

These emerging techniques could reveal how BCB4264_A5447 changes conformation during function, providing insights beyond static structural snapshots and enhancing our understanding of its biological role.

Citations A Study on Prevalence and Characterization of Bacillus cereus in Ready-to-Eat Foods in China. Frontiers in Microbiology, 2020. Bacillus cereus - Wikipedia. The Bacillus cereus Hbl and Nhe Tripartite Enterotoxin Components. PLOS ONE, 2013.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.