Recombinant Bacillus cereus UPF0059 membrane protein BCE33L5024 (BCE33L5024)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus cereus UPF0059 Membrane Protein BCE33L5024

Recombinant Bacillus cereus UPF0059 membrane protein BCE33L5024 (UniProt ID: Q630S4) is a bioengineered protein derived from the B. cereus strain ZK/E33L. It belongs to the UPF0059 family of uncharacterized proteins, which are hypothesized to perform membrane-associated functions. This protein is produced via recombinant expression systems, purified, and sold commercially for research purposes.

Production and Purification

BCE33L5024 is synthesized via recombinant DNA technology:

  1. Expression Host: Likely E. coli or B. subtilis (common systems for B. cereus proteins).

  2. Tagging: May include a His-tag or GST-tag for affinity purification, though the exact tag type is not disclosed .

  3. Purification:

    • Chromatography: Ion-exchange or affinity chromatography.

    • Concentration: Lyophilized or dissolved in optimized buffer.

Commercial Availability: Sold in 50 µg aliquots, with custom quantities available .

Genomic Context

BCE33L5024 is encoded by the BCE33L5024 gene in B. cereus strain ZK/E33L, part of a genome rich in transporters and stress-response proteins . The B. cereus pan-genome includes over 5,500 protein-coding genes, with UPF0059 proteins constituting a small fraction .

Comparative Analysis with Related Proteins

FeatureBCE33L5024 (Q630S4)BC3310 (Q81B77)Q812L9 (2FB5)
FunctionUnknownMultidrug effluxHypothetical
Transmembrane HelicesPredicted (HMMTOP)12 TMS 4 TMS
Crystal StructureNoNoYes (PDB: 2FB5)
Host StrainZK/E33LATCC 14579ATCC 14579

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; BCE33L5024; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus cereus (strain ZK / E33L)
Target Names
mntP
Target Protein Sequence
MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALKIRQILYIGVTIGIFHIIMPFIGMVLGR FLSEQYGDIAHFAGAILLIGLGFYIVYSSILENEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTVITILLFGFISMLLAWTGLFIGRHAKGMLGTYGEIVGGIILVGFGLYLLF PI
Uniprot No.

Target Background

Function
This protein is believed to function as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the structure and function of UPF0059 membrane protein BCE33L5024?

BCE33L5024 is a membrane protein from Bacillus cereus strain ZK/E33L belonging to the UPF0059 protein family. The protein consists of 182 amino acids with a sequence that suggests multiple transmembrane domains characteristic of integral membrane proteins . While specific functions remain under investigation, structural analysis indicates it likely spans the bacterial membrane multiple times. The highly hydrophobic nature of its amino acid sequence (MTFEQLIPLIIMAFALGMDAFSVSLGMGM...) suggests potential roles in membrane integrity, transport, or signaling processes .

Similar to other characterized B. cereus membrane proteins, BCE33L5024 may participate in processes such as:

  • Maintaining membrane integrity

  • Facilitating transport of molecules across membranes

  • Contributing to virulence mechanisms

  • Participating in stress responses

Researchers should approach functional characterization through comparative genomics with better-characterized membrane proteins from the Bacillus genus.

How does BCE33L5024 compare with other membrane proteins in Bacillus cereus?

BCE33L5024 differs from better-characterized membrane proteins like BC3310, which functions as a multidrug transporter in B. cereus. While BC3310 belongs to the Major Facilitator Superfamily with 12 predicted transmembrane helices and demonstrated efflux activity against compounds like ethidium bromide , BCE33L5024 belongs to the UPF0059 family with distinct structural features .

Unlike membrane proteins involved in extracellular vesicle formation and toxin delivery (such as those described in ), BCE33L5024 has not yet been directly linked to virulence mechanisms. This creates an important research opportunity to investigate potential roles in pathogenicity.

The following table compares key features of BCE33L5024 with another characterized B. cereus membrane protein:

FeatureBCE33L5024 (UPF0059)BC3310 (MFS Transporter)
FamilyUPF0059Major Facilitator Superfamily
Length182 amino acids~400 amino acids
Predicted functionUnknownMultidrug efflux
Demonstrated substratesNot determinedEthidium bromide, SDS, silver nitrate
Secondary structurePredicted α-helicalConfirmed α-helical (by CD spectroscopy)
ConservationWithin B. cereus groupPart of B. cereus core genome

What are the optimal conditions for expression and purification of recombinant BCE33L5024?

Expression and purification of membrane proteins like BCE33L5024 require specialized approaches:

Expression System Selection:

  • For initial characterization, E. coli expression systems (similar to those used for BC3310 in ) are recommended

  • For native interactions studies, consider B. subtilis expression systems which better represent the native Gram-positive environment

  • Codon optimization may be necessary for efficient heterologous expression

Purification Strategy:

  • Membrane isolation: Use differential centrifugation to isolate bacterial membranes

  • Solubilization: Test multiple detergents (DDM, LDAO, Triton X-100) at varying concentrations (0.5-2%) for optimal solubilization

  • Purification: Utilize affinity chromatography with appropriate tag (His6, as suggested in product specifications)

  • Buffer optimization: Include glycerol (20-50%) for stability as indicated in storage conditions

  • Quality control: Assess protein purity using SDS-PAGE and integrity using circular dichroism (similar to approach used for BC3310)

Working with the commercially available recombinant protein requires careful handling according to the specifications: storage at -20°C for long-term, avoiding repeated freeze-thaw cycles, and maintaining working aliquots at 4°C for no more than one week .

What approaches are recommended for investigating BCE33L5024 interactions with host cells?

To investigate potential interactions of BCE33L5024 with host cells, researchers should consider:

Membrane Localization Studies:

  • Generate fluorescently-tagged BCE33L5024 constructs

  • Express in B. cereus and observe localization during infection using confocal microscopy

  • Create domain deletion mutants to identify regions essential for localization

Host Cell Interaction Experiments:

  • Develop BCE33L5024 knockout strains using markerless deletion methods (similar to approach used for BC3310)

  • Compare wild-type and knockout strains in infection assays with relevant cell lines (e.g., intestinal epithelial cells)

  • Use purified recombinant BCE33L5024 in direct binding assays with host cell membrane fractions

Drawing from methodologies used to study B. cereus extracellular vesicles , researchers could investigate if BCE33L5024 is present in these vesicles and potentially delivered to host cells during infection.

How might BCE33L5024 contribute to B. cereus pathogenicity mechanisms?

While direct evidence linking BCE33L5024 to B. cereus pathogenicity is currently limited, multiple research directions could explore this possibility:

Potential Pathogenicity Mechanisms:

  • Membrane integrity and stress response: BCE33L5024 may contribute to bacterial survival under host-imposed stress conditions

  • Transport functions: The protein might facilitate transport of nutrients or export of virulence factors

  • Extracellular vesicle involvement: BCE33L5024 could be incorporated into B. cereus extracellular vesicles that deliver toxins to host cells

  • Immune modulation: The protein might interact with host cell receptors to modulate immune responses

Experimental Approaches:

  • Generate and characterize BCE33L5024 deletion mutants in infection models

  • Examine BCE33L5024 expression changes under infection-relevant conditions

  • Investigate potential interactions with known virulence factors

  • Perform proteomics analysis of membrane fractions during infection

Recent research has shown that B. cereus extracellular vesicles contain virulence-associated factors and elicit inflammatory responses in human monocytes . Investigating whether BCE33L5024 is present in these vesicles or contributes to their formation would be valuable.

What structural and functional insights could be gained through site-directed mutagenesis of BCE33L5024?

Site-directed mutagenesis represents a powerful approach to understand structure-function relationships in BCE33L5024:

Key Regions for Mutagenesis:

  • Predicted transmembrane domains

  • Conserved motifs across UPF0059 family members

  • Regions with high conservation across Bacillus species

Experimental Approach:

  • Identify conserved amino acids through multiple sequence alignment of UPF0059 family proteins

  • Generate point mutations using approaches similar to those used for BC3310 D105 mutations

  • Express mutant proteins and assess effects on:

    • Protein folding and stability (using circular dichroism)

    • Membrane localization

    • Bacterial physiology

    • Host cell interactions

Learning from studies on BC3310, where mutation of a conserved aspartate residue in transmembrane segment 4 (D105) affected function , researchers should target conserved charged residues within predicted transmembrane domains of BCE33L5024 for initial mutagenesis studies.

How conserved is BCE33L5024 across different B. cereus strains and related species?

Understanding the conservation of BCE33L5024 can provide insights into its evolutionary importance and potential functions:

Conservation Analysis Methodology:

  • Perform BLAST analysis using BCE33L5024 sequence against:

    • All sequenced B. cereus strains

    • B. thuringiensis, B. anthracis, and other Bacillus species

    • More distant Gram-positive bacteria

  • Calculate sequence identity and similarity percentages

  • Identify core conserved regions versus variable domains

  • Construct phylogenetic trees using approaches similar to those used for BC3310

Expected Outcomes:
If BCE33L5024 follows patterns observed with other membrane proteins like BC3310, it may be highly conserved within the B. cereus group, suggesting it may be part of the core genome serving fundamental physiological functions . Regions with high conservation likely indicate functionally or structurally critical domains.

What computational approaches can predict potential functions of BCE33L5024?

In the absence of direct experimental data, computational approaches can generate testable hypotheses about BCE33L5024 function:

Recommended Computational Approaches:

  • Structure prediction:

    • Submit BCE33L5024 sequence to AlphaFold or similar tools

    • Identify potential binding pockets or functional domains

    • Compare with structures of characterized membrane proteins

  • Function prediction:

    • Search for conserved domains using InterPro, Pfam

    • Perform Gene Ontology enrichment analysis

    • Use gene neighborhood analysis to identify functionally related genes

  • Protein-protein interaction prediction:

    • Use STRING database to identify potential interaction partners

    • Look for co-expression patterns in transcriptomic datasets

    • Analyze genetic context of the gene in the B. cereus genome

These computational predictions should guide subsequent experimental validation approaches.

What are common challenges in working with BCE33L5024 and how can they be addressed?

Membrane proteins present unique challenges in research settings:

Challenge 1: Protein Solubility and Stability

  • Issue: Precipitation during purification

  • Solution: Optimize detergent selection (test DDM, LDAO, Fos-choline); include stabilizers like glycerol (20-50%) in buffers ; maintain temperature control during purification

Challenge 2: Low Expression Yields

  • Issue: Poor expression of functional protein

  • Solution: Test different expression systems; optimize codon usage; use fusion tags that enhance expression; consider cell-free expression systems for toxic proteins

Challenge 3: Proper Folding Verification

  • Issue: Ensuring proper folding of recombinant protein

  • Solution: Use circular dichroism to confirm α-helical structure (as done for BC3310) ; perform functional assays; use limited proteolysis to assess structural integrity

Challenge 4: Functional Characterization

  • Issue: Determining function without known substrates or interacting partners

  • Solution: Perform comparative analyses with better-characterized family members; use untargeted approaches like bacterial two-hybrid screens; test multiple potential substrates in transport assays

How can researchers verify the quality and activity of commercially obtained BCE33L5024?

When working with commercially obtained recombinant BCE33L5024 , researchers should perform quality control tests:

Quality Control Checklist:

  • Purity assessment: Run SDS-PAGE analysis to confirm single band at expected molecular weight

  • Identity confirmation: Perform Western blot with antibodies against the protein or tag

  • Structural integrity: Use circular dichroism to verify expected secondary structure patterns

  • Functional testing: Develop reconstitution assays in liposomes to test membrane integration

  • Stability testing: Monitor protein stability over time using size exclusion chromatography

Storage and Handling Recommendations:

  • Store stock at -20°C or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles

  • Maintain working aliquots at 4°C for no more than one week

  • Consider adding protease inhibitors to working solutions

What emerging technologies could advance understanding of BCE33L5024 function?

Several cutting-edge approaches could accelerate functional characterization of BCE33L5024:

Advanced Structural Analysis:

  • Cryo-electron microscopy for high-resolution structure determination

  • Native mass spectrometry to identify potential binding partners

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

Systems Biology Approaches:

  • Transcriptomics to identify conditions that regulate BCE33L5024 expression

  • Metabolomics to identify changes associated with BCE33L5024 deletion

  • Network analysis to position BCE33L5024 in B. cereus physiological pathways

Advanced Imaging Techniques:

  • Super-resolution microscopy (similar to 3D-SIM used for B. cereus vesicles) to visualize BCE33L5024 localization during infection

  • FRET-based biosensors to detect conformational changes in response to potential substrates

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.