Recombinant Bacillus cereus UPF0059 membrane protein BCE_5451 (BCE_5451)

Shipped with Ice Packs
In Stock

Description

Production and Handling

BCE_5451 is produced via recombinant expression in E. coli, followed by purification using His-tag affinity chromatography. Critical handling parameters include:

ParameterRecommendation
ReconstitutionUse deionized sterile water. Add 5–50% glycerol (v/v) for stability.
Storage-20°C or -80°C for long-term storage. Avoid repeated freeze-thaw cycles.
BufferTris/PBS-based buffer with 6% trehalose, pH 8.0 .

3.1. Membrane Protein Studies

BCE_5451 is used to investigate Bacillus cereus membrane biology, particularly in spore and vegetative cell membranes. While not directly studied in spore inner membrane proteomes , its classification as a UPF0059 protein aligns with broader research on Bacillus membrane proteins:

  • Spore Inner Membrane: Enriched with germinant receptors and spore-specific proteins, though BCE_5451 is not explicitly identified in these fractions .

  • Vegetative Cell Membrane: Dominated by transporters, receptors, and motility-related proteins, which may share functional parallels with BCE_5451 .

3.2. Diagnostic and Detection Tools

Recombinant BCE_5451 is utilized in ELISA kits for detecting Bacillus cereus or studying UPF0059 family interactions. These assays leverage the protein’s His-tag for antibody binding .

Functional Hypotheses

While no direct studies confirm BCE_5451’s function, its association with mntP (manganese efflux pump) suggests roles in:

  1. Metal Ion Transport: Regulating intracellular manganese levels, critical for enzymatic activity and oxidative stress resistance.

  2. Sensory Transduction: Potentially sensing environmental cues (e.g., pH, metal availability) via membrane localization.

Comparative Context

BCE_5451 is part of a larger Bacillus cereus membrane proteome, which includes:

  • Spore-Specific Proteins: Germinant receptors (e.g., SleB, HtrC orthologs) and spore coat components .

  • Vegetative Cell Proteins: Flagellins (linked to motility ), transporters, and division/motility factors .

Protein TypeSpore Inner MembraneVegetative Cell Membrane
TransportersLimited (e.g., glucose/fructose)Abundant (diverse substrates)
Motility FactorsNoneFlagellins, chemotaxis sensors
Germination ReceptorsPresent (e.g., SleB, HtrC-like)Absent

Challenges and Gaps

  1. Functional Characterization: No studies directly link BCE_5451 to manganese efflux or sensory pathways.

  2. Strain-Specific Variability: Bacillus cereus strains exhibit diverse genetic backgrounds (e.g., toxin gene prevalence) , potentially influencing BCE_5451’s role.

  3. Structural Insights: The protein’s 3D structure and membrane topology remain uncharacterized.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
mntP; BCE_5451; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus cereus (strain ATCC 10987 / NRS 248)
Target Names
mntP
Target Protein Sequence
MTFEQLIPLIIMAFALGMDAFSVSLGMGMMTLKIRQILYIGVTIGIFHIIMPFIGMVLGR FLSEQYGDIAHFAGAILLIGLGFYIVYSSILENEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTIITILLFGFVSMLLAWIGLFIGRHAKDMLGTYGEIVGGIILVGFGLYLLF PI
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links

KEGG: bca:BCE_5451

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.