Recombinant Bacillus cereus UPF0059 membrane protein BCG9842_B5505 (BCG9842_B5505)

Shipped with Ice Packs
In Stock

Description

Production and Purification Protocols

Produced through recombinant DNA technology with these standardized parameters:

  • Expression System: E. coli BL21(DE3) optimized for membrane proteins

  • Purification Method: Immobilized metal affinity chromatography (IMAC) via N-terminal His-tag

  • Yield: 0.5-1.2 mg/L culture (typical for membrane proteins)

  • Purity: >90% as verified by SDS-PAGE

  • Formulation: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Insights from Genomic Studies

Recent whole-genome sequencing of pathogenic B. cereus strains (LY01-LY09) revealed:

  • Manganese transporters show evolutionary conservation across Bacillus species

  • Metal ion regulation impacts virulence factor expression, including:

    • Non-ribosomal peptide synthetase (NRPS) systems

    • Cereulide toxin production via ces gene clusters

  • Membrane proteins like BCG9842_B5505 may influence:

    • Oxidative stress response

    • Biofilm formation

    • Antibiotic resistance mechanisms

Research Applications

Current experimental uses include:

  1. Structural studies of bacterial metal transport mechanisms

  2. Development of inhibition assays for manganese-dependent pathogens

  3. Immunogen production for antibody development

  4. Comparative analyses with homologs in B. anthracis and B. thuringiensis

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; BCG9842_B5505; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus cereus (strain G9842)
Target Names
mntP
Target Protein Sequence
MTFEQLIPLIIMAFALGMDAFSVSLGMGMMPLKLRQILYIGMTIGIFHIIMPFIGMVLGR FLSEKYGDIAHFAGAILLIGLGFYIVYSTILQNGETRTVPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTIITILLFGFVSMLLAWIGLLIGRHAKDMLGTYGEIVGGIILVGFGLYILF PI
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0059 membrane protein BCG9842_B5505 and what organism does it originate from?

The UPF0059 membrane protein BCG9842_B5505 is a membrane protein from Bacillus cereus strain G9842. It belongs to the UPF0059 protein family, which consists of uncharacterized membrane proteins found in various bacterial species. This specific protein has a full length of 182 amino acids and is typically studied in its recombinant form with an N-terminal His-tag for easier purification and detection . Bacillus cereus is a Gram-positive, facultative anaerobic bacterium known for its ability to form endospores and its relevance as a food-borne pathogen .

What expression systems are commonly used for this protein, and why?

E. coli expression systems are predominantly used for recombinant production of BCG9842_B5505 protein. This is because E. coli offers several advantages for membrane protein expression, including:

  • Rapid growth to high densities in inexpensive media

  • Genetic tractability allowing for optimization of expression conditions

  • Well-established protocols for membrane protein isolation

  • Ability to produce relatively high yields in short timeframes

The specific BCG9842_B5505 protein in the commercial preparation is expressed in E. coli with an N-terminal His-tag, which facilitates purification using metal affinity chromatography . While other expression systems like yeast or insect cells could potentially be used, E. coli remains the cornerstone of recombinant membrane protein production, especially for initial characterization studies .

What are the storage and reconstitution recommendations for this recombinant protein?

Based on standard protocols for similar recombinant membrane proteins, the following storage and reconstitution recommendations apply:

  • Store lyophilized powder at -20°C to -80°C

  • Avoid repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Working aliquots may be stored at 4°C for up to one week

For optimal results, the vial should be briefly centrifuged prior to opening to bring contents to the bottom. Once reconstituted, the protein solution should be handled with care to maintain its structural integrity and biological activity .

What are the optimal conditions for expressing BCG9842_B5505 in E. coli?

Optimal expression of BCG9842_B5505 in E. coli requires careful consideration of several parameters:

ParameterRecommended ConditionsRationale
Host strainBL21(DE3), C41(DE3), C43(DE3)These strains are engineered to better tolerate membrane protein overexpression
Expression vectorpET series with T7 promoterAllows for tight regulation and high expression
InductionIPTG at 0.1-0.5 mMLower concentrations often yield better-folded membrane proteins
Temperature16-25°C post-inductionLower temperatures slow expression and improve folding
MediaTerrific Broth or 2xYTRicher media support higher cell densities
Induction timingMid-log phase (OD600 ≈ 0.6-0.8)Balances biomass with expression capacity

The successful overproduction of membrane proteins is linked to avoiding stress responses in the host cell . Using specialized E. coli strains like C41(DE3) or C43(DE3), which were selected for their ability to better tolerate membrane protein overexpression, can significantly improve yields . Additional optimization may include adjusting the growth temperature, inducer concentration, and expression duration based on protein-specific requirements.

What purification strategy is most effective for isolating BCG9842_B5505 protein?

A multi-step purification strategy is typically recommended for membrane proteins like BCG9842_B5505:

  • Membrane isolation: Cells are disrupted by methods such as sonication or French press, followed by differential centrifugation to isolate membrane fractions .

  • Solubilization: Membrane proteins are extracted using detergents such as n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin, which disrupt the membrane while maintaining protein structure .

  • Affinity chromatography: The His-tagged BCG9842_B5505 can be purified using immobilized metal affinity chromatography (IMAC) with Ni-NTA or Co-NTA resins .

  • Size exclusion chromatography: Further purification can be achieved through gel filtration to separate the protein from aggregates and other contaminants .

  • Quality assessment: SDS-PAGE, Western blotting, and mass spectrometry can be used to verify purity, which should be greater than 90% for most research applications .

The choice of detergent is critical, as it affects both extraction efficiency and protein stability. A detergent screen may be necessary to identify optimal conditions for BCG9842_B5505 purification.

What is currently known about the structure and function of UPF0059 family proteins?

The UPF0059 protein family, to which BCG9842_B5505 belongs, remains largely uncharacterized in terms of its precise biological function. Current understanding suggests:

  • UPF0059 proteins are predicted membrane proteins with multiple transmembrane domains

  • They are conserved across various bacterial species, suggesting an important cellular role

  • Some members show sequence similarity to transporters or channels

Structural information is limited, but bioinformatics analyses predict that these proteins typically contain 4-6 transmembrane helices. The high conservation across diverse bacterial species suggests an essential cellular function, possibly related to membrane integrity, transport, or signaling .

Comparative analysis of membrane proteomes in Bacillus cereus has revealed that membrane proteins play crucial roles in diverse cellular functions, including signal transduction and transport of metabolites . While the specific function of BCG9842_B5505 has not been definitively established, its localization in the membrane suggests it may be involved in similar processes.

What methods are recommended for functional characterization of this membrane protein?

Researchers investigating the function of BCG9842_B5505 should consider a multi-faceted approach:

ApproachMethodologyExpected Outcome
Genetic analysisGene knockout or knockdownPhenotypic effects indicating function
Localization studiesFluorescent tagging, immunolocalizationSubcellular localization patterns
Protein-protein interactionsPull-down assays, cross-linking, BioIDIdentification of interaction partners
Transport assaysLiposome reconstitution, electrophysiologyPotential transport function and specificity
Structural studiesCryo-EM, X-ray crystallographyStructural insights into function

Given that membrane proteins like BCG9842_B5505 can be challenging to analyze , a combination of these approaches provides the most comprehensive understanding. For instance, comparative proteomic studies between spore and vegetative cell membrane fractions have been successfully used to characterize membrane proteins in Bacillus cereus . Similar approaches could be applied to understand the role of BCG9842_B5505 in different growth phases or under various environmental conditions.

How does BCG9842_B5505 compare to other UPF0059 membrane proteins like BVU_2631?

Comparison between BCG9842_B5505 from Bacillus cereus and BVU_2631 from Bacteroides vulgatus reveals both similarities and differences:

The annotation of BVU_2631 as a putative manganese efflux pump (gene name: mntP) provides a potential clue to the function of BCG9842_B5505, as proteins within the same family often share similar functions. This comparison suggests that BCG9842_B5505 might be involved in metal ion homeostasis, possibly as a transporter for manganese or other divalent cations.

How can this protein be used in the study of bacterial membrane physiology?

BCG9842_B5505 can serve as a valuable tool in several research contexts:

  • Membrane proteome studies: As demonstrated in comprehensive studies of B. cereus membrane proteomes , this protein can be used as a marker or target in comparative proteomics between different growth conditions or life stages.

  • Membrane protein topology analysis: The protein can serve as a model for studying membrane protein insertion and topology using techniques such as cysteine scanning mutagenesis or reporter fusion approaches .

  • Bacterial stress response investigations: Studies have shown that membrane protein production can trigger specific stress responses in bacteria . BCG9842_B5505 could be used to investigate how B. cereus responds to membrane perturbations.

  • Transport and signaling research: If functional characterization confirms a role in transport or signaling, the protein could be used to study these processes in bacterial membranes .

  • Antimicrobial development: Understanding the structure and function of bacterial membrane proteins can potentially lead to the development of new antimicrobial strategies targeting these essential components .

What challenges might researchers encounter when working with BCG9842_B5505, and how can they be addressed?

Researchers working with BCG9842_B5505 may face several challenges common to membrane protein research:

ChallengeSolution ApproachScientific Rationale
Low expression levelsScreen multiple expression constructs (varying tags, fusion partners)Different constructs can dramatically affect expression levels
Toxicity to host cellsUse specialized strains (C41/C43) or tunable expression systemsReducing expression rate can minimize toxicity
Protein misfoldingLower induction temperature (16-20°C) and inducer concentrationSlower expression promotes proper folding
Poor solubilizationScreen multiple detergents and lipid-like moleculesDifferent detergents have varying efficacy for different proteins
Limited stabilityAdd stabilizing additives (glycerol, specific lipids)These compounds can enhance protein stability
Functional assay developmentUse proteoliposome reconstitution or nanodiscsMembrane environment is crucial for proper function

Additionally, membrane protein research often suffers from reproducibility issues. Implementing standardized protocols and thorough documentation of experimental conditions is crucial. The cell response to membrane protein production has been quantified, and several genes that are either upregulated or downregulated when yields of a membrane-inserted protein are poor have been identified . Monitoring these marker genes can provide valuable feedback during optimization of expression conditions.

What techniques are recommended for studying the role of BCG9842_B5505 in Bacillus cereus spore formation?

Investigating the role of BCG9842_B5505 in spore formation requires specialized approaches that bridge membrane protein biology with sporulation research:

  • Temporal expression analysis: Quantitative proteomics comparing vegetative cells and various stages of sporulation can reveal when BCG9842_B5505 is most abundant, providing clues to its function .

  • Localization during sporulation: Fluorescent protein fusions or immunolocalization can track where BCG9842_B5505 is found during the sporulation process - whether it remains in the vegetative cell membrane or becomes incorporated into the spore inner membrane .

  • Knockout/knockdown studies: Creating gene deletion mutants and assessing their ability to form normal spores can reveal whether BCG9842_B5505 is essential for sporulation .

  • Protein-protein interaction networks: Identifying interaction partners specific to sporulation can place BCG9842_B5505 in the context of known sporulation pathways .

  • Germination studies: If BCG9842_B5505 is present in the spore inner membrane, germination assays with knockout mutants can reveal potential roles in the transition from dormancy to vegetative growth .

Research has shown that the spore inner membrane acts not only as a barrier for undesired molecules but also as a scaffold for proteins involved in signal transduction and the transport of metabolites during spore germination . Determining whether BCG9842_B5505 participates in these processes would provide valuable insights into both protein function and spore biology.

How does the expression of BCG9842_B5505 compare between vegetative cells and spores?

While specific data on BCG9842_B5505 expression is not directly provided in the search results, comparative proteomics studies of B. cereus membrane proteins offer relevant insights:

Comprehensive analysis of B. cereus membrane proteomes has identified 498 vegetative cell membrane proteins and 244 spore inner membrane proteins . These studies revealed that:

  • 54 proteins are specific to the spore membrane

  • 308 proteins are specific to the vegetative cell membrane

  • The remaining proteins are common to both but often expressed at different levels

To determine where BCG9842_B5505 falls within this distribution, researchers could:

  • Reference existing proteomic databases for B. cereus

  • Perform Western blot analysis with anti-His antibodies on membrane fractions from both life stages

  • Conduct targeted mass spectrometry to quantify BCG9842_B5505 abundance

The functional characterization of these proteins showed that the cell membrane proteome has a larger number of transporters, receptors, and proteins related to cell division and motility, while the spore inner membrane had specific expression of several germinant receptors and spore-specific proteins . Determining which category BCG9842_B5505 belongs to would provide important clues about its physiological role.

What bioinformatic approaches can help predict the function of BCG9842_B5505?

Several bioinformatic approaches can provide insights into the potential function of this uncharacterized protein:

Bioinformatic ApproachApplication to BCG9842_B5505Expected Insights
Homology modelingComparison with structurally characterized proteinsStructural features and potential binding sites
Phylogenetic analysisEvolutionary relationships with characterized proteinsFunctional conservation and divergence
Transmembrane topology predictionIdentification of membrane-spanning regionsMembrane orientation and potential functional domains
Conserved domain analysisIdentification of functional motifsPotential enzymatic or binding activities
Genomic context analysisExamination of neighboring genesFunctional associations and operons
Protein-protein interaction predictionsIdentification of potential binding partnersInvolvement in specific cellular processes

Studies on uncharacterized membrane proteins in B. cereus have shown that homology searching can be particularly valuable . For example, some uncharacterized proteins showed homology with enzymatic functions or lipid-binding properties in other organisms. Similar approaches could reveal whether BCG9842_B5505 shares homology with the putative manganese efflux pump function identified for the related BVU_2631 protein , or has other potential functions.

What advanced experimental designs would help resolve the structure-function relationship of BCG9842_B5505?

To comprehensively understand the structure-function relationship of BCG9842_B5505, researchers should consider these advanced experimental approaches:

  • Cryo-electron microscopy (Cryo-EM): This technique can reveal the three-dimensional structure of the protein in a near-native state, potentially identifying functional domains and binding sites .

  • Site-directed mutagenesis combined with functional assays: Systematic mutation of conserved residues followed by functional testing can identify critical amino acids for protein function .

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can reveal dynamic aspects of protein structure and conformational changes upon ligand binding or environmental changes .

  • Cross-linking mass spectrometry: This technique can identify interaction partners and proximity relationships within protein complexes .

  • Native mass spectrometry: Analysis of the intact protein complex can provide insights into oligomerization state and non-covalent interactions .

  • Reconstitution studies: Incorporating the purified protein into artificial membrane systems (liposomes, nanodiscs) allows for controlled functional studies in a membrane environment .

The translocon, which is the site of protein translocation and membrane insertion, plays a crucial role in determining whether a protein segment is integrated into the membrane . Understanding how BCG9842_B5505 interacts with the translocon machinery could provide insights into its topology and function. Recent advances in membrane protein research techniques make it increasingly feasible to obtain high-resolution structural and functional data even for challenging membrane proteins like BCG9842_B5505.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.